DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ davies-2012-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Davies DR., Gelinas AD., Zhang C., Rohloff JC., Carter JD., O'Connell D., Waugh SM., Wolk SK., Mayfield WS., Burgin AB., Edwards TE., Stewart LJ., Gold L., Janjic N., Jarvis TC. DIP original experiment: DIP-251834X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Unique motifs and hydrophobic interactions shape the binding of modified DNA ligands to protein targets. Davies DR., Gelinas AD., Zhang C., Rohloff JC., Carter JD., O'Connell D., Waugh SM., Wolk SK., Mayfield WS., Burgin AB., Edwards TE., Stewart LJ., Gold L., Janjic N., Jarvis TC. Only protein-protein interactions imex curation pdgfb_human Platelet-derived growth factor subunit B Platelet-derived growth factor B chain Platelet-derived growth factor beta polypeptide PDGF-2 Proto-oncogene c-Sis PDGFB PDGF2 SIS protein protein human Homo sapiens Human MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA pdgfb-7 3247013 N/A 3247014 unspecified role unspecified role unspecified role unspecified role Region 82-190 Region 82-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false