DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2012-101 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251355X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation zhang-2012-102 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251360X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation zhang-2012-103 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251362X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation zhang-2012-104 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251356X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation zhang-2012-105 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251359X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation zhang-2012-106 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251357X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation zhang-2012-107 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251361X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation zhang-2012-108 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251363X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation zhang-2012-109 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. DIP original experiment: DIP-251358X Structure (London, England : 1993) 2012 IMEx Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang T., Péli-Gulli MP., Yang H., De Virgilio C., Ding J. Only protein-protein interactions imex curation slm4_yeast Protein SLM4 YBR077C YBR0723 GSE complex subunit 1 EGO complex subunit 3 SLM4 EGO3 GSE1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVMLHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSINEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG D64ABDE1CDF265FD gtr2_yeast GTP-binding protein GTR2 YGR163W GTR2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLEATDSKAMVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPVLRNSQKSSDKDNVINPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDIWANARASQAKNSIEDDV 0A0D16C81F73184D gtr1_yeast GTP-binding protein GTR1 YM7056.05 YML121W GTR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNMTLNLWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPDAKIFVLLHKMDLVQLDKREELFQIMMKNLSETSSEFGFPNLIGFPTSIWDESLYKAWSQIVCSLIPNMSNHQSNLKKFKEIMNALEIILFERTTFLVICSSNGENSNENHDSSDNNNVLLDPKRFEKISNIMKNFKQSCTKLKSGFKTLILNNNIYVSELSSNMVCFIVLKDMNIPQELVLENIKKAKEFFQ B79CE7FE7AD2FDBE meh1_yeast Protein MEH1 GSE complex subunit 2 EGO complex subunit 1 YKR007W YK106 MEH1 EGO1 GSE2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGAVLSCCRNHSGEENEALLREQQAGYGSQGNANDEYDAEQMRLKEHEHEQKLLAREQELRDIVANTNDKLIDISMINNSGIVIQGTDLQEALDKRQQEEGGDSREDERSAGDDNLSGHSVPSSGSAQATTHQTAPRTNTFTLLTSPDSAKISKEQLKKLHSNILNEIFSQSQVNKPGPLTVPF 995DD1E68331D050 ego3-1 3246752 N/A 3246761 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ego3-gtr2-1 3246753 N/A 3246762 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246761 unspecified role unspecified role bait bait Region 1-17 Region 1-17 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 21-30 Region 21-30 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P38247:p.[Asn67Ala;Asn68Ala;Lys70Ala;Met71Ala] N67A/N68A/K70A/M71A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false gtr1-gtr2-1 3246754 N/A 3246762 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246763 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ego3-2 3246755 N/A 3246761 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ego3-gtr1-1 3246756 N/A 3246763 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246761 unspecified role unspecified role bait bait Region 1-17 Region 1-17 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 21-30 Region 21-30 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P38247:p.[Asn67Ala;Asn68Ala;Lys70Ala;Met71Ala] N67A/N68A/K70A/M71A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ego3-ego3-1 3246757 N/A 3246761 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246761 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false gtr1-ego1-1 3246758 N/A 3246762 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246761 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246764 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246763 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false gtr1-ego3-1 3246759 N/A 3246761 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P38247:p.[Asn67Ala;Asn68Ala;Lys70Ala;Met71Ala] N67A/N68A/K70A/M71A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246763 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ego3-ego1-1 3246760 N/A 3246764 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246761 unspecified role unspecified role bait bait Region 1-17 Region 1-17 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 21-30 Region 21-30 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false