DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ watanabe-2012-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251346X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation watanabe-2012-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251351X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation watanabe-2012-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251349X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation watanabe-2012-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251352X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation watanabe-2012-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251353X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation watanabe-2012-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251347X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation watanabe-2012-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251350X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation watanabe-2012-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251348X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation watanabe-2012-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. DIP original experiment: DIP-251354X Structure (London, England : 1993) 2012 IMEx Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation. Watanabe S., Matsumi R., Atomi H., Imanaka T., Miki K. Only protein-protein interactions imex curation q5jii1_theko Tk-hypD TK2000 protein protein theko Thermococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) Pyrococcus kodakaraensis (strain KOD1) MEEPFEAYRSREVAMKLVEKIREEAKTLDGEIRIMHVCGTHEDTVTRHGIRSLLPENVKVVSGPGCPVCITPVEDIVAMQLIMRKAREEGEEIILTTFGDMYKIPTPMGSFADLKSEGFDVRIVYGIFDTYRIAKENPDKTVVHFSPGFETTTAPAAGMLNVAAQEELENFKIYSVHRLTPPAVEVLLKQGTVFQGLIAPGHVSTIIGVKGWEYLTEKYGIPQVVAGFEPNDVLMAILMLIRMYKEGEARIINEYERAVKYEGNVVAQKMIDKFFEVVDAKWRALGVFPKSGLELRKEWKDFEIRSFYKVEVPKNLPDLEKGCRCGAVLRGLALPTDCPLFGKTCTPRHPVGPCMVSYEGTCQIFYKYGVLF q5jii0_theko Tk-hypC TK2001 protein protein theko Thermococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) Pyrococcus kodakaraensis (strain KOD1) MCLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAMEGF q5jii7_theko TK1993 protein protein theko Thermococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) Pyrococcus kodakaraensis (strain KOD1) MGEKIKLEHGAGGEIMEELLRDVILKTLTLKSAGGIGLDALDDGATIPFGDKHIVFTIDGHTVKPLFFPGGDIGRLAVSGTVNDLAVMGAEPIALANSMIIGEGLDMEVLKRVLKSMDETAREVPVPIVTGDTKVVEDKIEMFVITAGIGIAEHPVSDAGAKVGDAVLVSGTIGDHGIALMSHREGIAFETELKSDVAPIWDVVKAVAETIGWENIHAMKDPTRAGLSNALNEIARKSNVGILVREADIPIRPEVRAASEMLGISPYDVANEGKVVMVVAREYAEEALEAMRKTEKGRNAAIIGEVIADYRGKVLLETGIGGKRFMEPPEGDPVPRIC tk_hypc-tk_hypd-1 3246697 N/A 3246706 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246707 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tk_hypc-tk_hypd-2 3246698 N/A 3246706 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246707 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q5jii7_theko-1 3246699 N/A 3246708 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tk_hypd-tk_hypc-1 3246700 N/A 3246706 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3246707 unspecified role unspecified role prey prey Q5JII0:p.Phe48Arg F48R/E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q5JII0:p.Leu32Ala L32A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q5JII0:p.Leu32Asp L32D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q5JII0:p.Ile50Ala I50A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q5JII0:p.Ile50Glu I50E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q5JII0:p.Ile43Ala I43A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q5JII0:p.Ile43Asp I43D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q5JII0:p.Phe48Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tk_hypd-q5jii7_theko-1 3246701 N/A 3246708 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246706 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3246707 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false tk_hypc-tk_hypd-3 3246702 N/A 3246706 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246707 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q5jii7_theko-tk_hypc-1 3246703 N/A 3246708 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246706 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246707 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q5jii7_theko-tk_hypc-2 3246704 N/A 3246708 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246706 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246707 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false tk_hypd-q5jii7_theko-2 3246705 N/A 3246708 unspecified role unspecified role prey prey Q5JII7:p.Ile320Ala I320A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q5JII7:p.Ile320Glu I320E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q5JII7:p.Arg324Glu R324E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246706 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false