DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nelson-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. DIP original experiment: DIP-251192X Structure (London, England : 1993) 2012 IMEx RANKL employs distinct binding modes to engage RANK and the osteoprotegerin decoy receptor. Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. Only protein-protein interactions imex curation nelson-2012-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. DIP original experiment: DIP-251198X Structure (London, England : 1993) 2012 IMEx RANKL employs distinct binding modes to engage RANK and the osteoprotegerin decoy receptor. Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. Only protein-protein interactions imex curation nelson-2012-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. DIP original experiment: DIP-251193X Structure (London, England : 1993) 2012 IMEx RANKL employs distinct binding modes to engage RANK and the osteoprotegerin decoy receptor. Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. Only protein-protein interactions imex curation nelson-2012-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. DIP original experiment: DIP-251195X Structure (London, England : 1993) 2012 IMEx RANKL employs distinct binding modes to engage RANK and the osteoprotegerin decoy receptor. Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. Only protein-protein interactions imex curation nelson-2012-5 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. DIP original experiment: DIP-251197X Structure (London, England : 1993) 2012 IMEx RANKL employs distinct binding modes to engage RANK and the osteoprotegerin decoy receptor. Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. Only protein-protein interactions imex curation nelson-2012-6 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. DIP original experiment: DIP-251199X Structure (London, England : 1993) 2012 IMEx RANKL employs distinct binding modes to engage RANK and the osteoprotegerin decoy receptor. Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. Only protein-protein interactions imex curation nelson-2012-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. DIP original experiment: DIP-251194X Structure (London, England : 1993) 2012 IMEx RANKL employs distinct binding modes to engage RANK and the osteoprotegerin decoy receptor. Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. Only protein-protein interactions imex curation nelson-2012-8 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. DIP original experiment: DIP-251196X Structure (London, England : 1993) 2012 IMEx RANKL employs distinct binding modes to engage RANK and the osteoprotegerin decoy receptor. Nelson CA., Warren JT., Wang MW., Teitelbaum SL., Fremont DH. Only protein-protein interactions imex curation o35235-1 Tumor necrosis factor ligand superfamily member 11 Tnfsf11 Opgl Rankl Trance Osteoclast differentiation factor Osteoprotegerin ligand Receptor activator of nuclear factor kappa-B ligand TNF-related activation-induced cytokine protein protein mouse Mus musculus Mouse MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID tnr11_mouse Tumor necrosis factor receptor superfamily member 11A Receptor activator of NF-KB Osteoclast differentiation factor receptor Tnfrsf11a Rank protein protein mouse Mus musculus Mouse MAPRARRRRQLPAPLLALCVLLVPLQVTLQVTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSLIVLLLFISVVVVAAIIFGVYYRKGGKALTANLWNWVNDACSSLSGNKESSGDRCAGSHSATSSQQEVCEGILLMTREEKMVPEDGAGVCGPVCAAGGPWAEVRDSRTFTLVSEVETQGDLSRKIPTEDEYTDRPSQPSTGSLLLIQQGSKSIPPFQEPLEVGENDSLSQCFTGTESTVDSEGCDFTEPPSRTDSMPVSPEKHLTKEIEGDSCLPWVVSSNSTDGYTGSGNTPGEDHEPFPGSLKCGPLPQCAYSMGFPSEAAASMAEAGVRPQDRADERGASGSGSSPSDQPPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGPGSAEPESEPVGRPVQEETLAHRDSFAGTAPRFPDVCATGAGLQEQGAPRQKDGTSRPVQEQGGAQTSLHTQGSGQCAE tr11b_mouse Tumor necrosis factor receptor superfamily member 11B Tnfrsf11b Ocif Opg Osteoclastogenesis inhibitory factor Osteoprotegerin protein protein mouse Mus musculus Mouse MNKWLCCALLVLLDIIEWTTQETLPPKYLHYDPETGHQLLCDKCAPGTYLKQHCTVRRKTLCVPCPDHSYTDSWHTSDECVYCSPVCKELQSVKQECNRTHNRVCECEEGRYLEIEFCLKHRSCPPGSGVVQAGTPERNTVCKKCPDGFFSGETSSKAPCIKHTNCSTFGLLLIQKGNATHDNVCSGNREATQKCGIDVTLCEEAFFRFAVPTKIIPNWLSVLVDSLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNRDQEMVKKIIQDIDLCESSVQRHLGHSNLTTEQLLALMESLPGKKISPEEIERTRKTCKSSEQLLKLLSLWRIKNGDQDTLKGLMYALKHLKTSHFPKTVTHSLRKTMRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL tnfsf11-1 3245454 N/A 3245462 unspecified role unspecified role unspecified role unspecified role Region 162-316 Region 162-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfsf11-tnfrsf11a-1 3245455 N/A 3245463 unspecified role unspecified role prey prey Region 1-198 Region 1-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245462 unspecified role unspecified role bait bait Region 162-316 Region 162-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfrsf11b-tnfsf11-3 3245456 N/A 3245464 unspecified role unspecified role unspecified role unspecified role Region 22-197 Region 22-197 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245462 unspecified role unspecified role unspecified role unspecified role Region 162-316 Region 162-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfrsf11a-tnfsf11-14 3245457 N/A 3245463 unspecified role unspecified role unspecified role unspecified role Region 1-198 Region 1-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245462 unspecified role unspecified role unspecified role unspecified role Region 162-316 Region 162-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfsf11-tnfrsf11b-3 3245458 N/A 3245464 unspecified role unspecified role prey prey Region 22-191 Region 22-191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O08712:p.Phe117Ala F117A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3245462 unspecified role unspecified role bait bait Region 162-316 Region 162-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfsf11-tnfrsf11a-2 3245459 N/A 3245463 unspecified role unspecified role prey prey Region 1-198 Region 1-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245462 unspecified role unspecified role bait bait Region 162-316 Region 162-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfrsf11b-tnfsf11-4 3245460 N/A 3245464 unspecified role unspecified role unspecified role unspecified role Region 22-197 Region 22-197 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245462 unspecified role unspecified role unspecified role unspecified role Region 162-316 Region 162-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfsf11-tnfrsf11b-4 3245461 N/A 3245464 unspecified role unspecified role prey prey Region 22-191 Region 22-191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O08712:p.Phe117Ala F117A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O08712:p.Phe117Leu F117L mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3245462 unspecified role unspecified role bait bait Region 162-316 Region 162-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false