DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ borodavka-2012-1 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Borodavka A., Tuma R., Stockley PG. DIP original experiment: DIP-253605X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Evidence that viral RNAs have evolved for efficient, two-stage packaging. Borodavka A., Tuma R., Stockley PG. Only protein-protein interactions imex curation capsd_bpms2 Capsid protein Coat protein protein protein bpms2 Enterobacteria phage MS2 MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY capsd_bpms2-2 3245201 N/A 3245202 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false