DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ koehn-2012-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Koehn EM., Perissinotti LL., Moghram S., Prabhakar A., Lesley SA., Mathews II., Kohen A. DIP original experiment: DIP-251794X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Folate binding site of flavin-dependent thymidylate synthase. Koehn EM., Perissinotti LL., Moghram S., Prabhakar A., Lesley SA., Mathews II., Kohen A. Only protein-protein interactions imex curation thyx_thema Flavin-dependent thymidylate synthase thyX thy1 TM_0449 FAD-dependent thymidylate synthase Thymidylate synthase ThyX protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV thyx-1 3245197 N/A 3245198 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false