DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ andersen-2012-1 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. DIP original experiment: DIP-250715X Nature 2012 IMEx Structure of the haptoglobin-haemoglobin complex. Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. Only protein-protein interactions imex curation andersen-2012-2 in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. DIP original experiment: DIP-250713X Nature 2012 IMEx Structure of the haptoglobin-haemoglobin complex. Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. Only protein-protein interactions imex curation andersen-2012-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. DIP original experiment: DIP-250716X Nature 2012 IMEx Structure of the haptoglobin-haemoglobin complex. Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. Only protein-protein interactions imex curation andersen-2012-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. DIP original experiment: DIP-250714X Nature 2012 IMEx Structure of the haptoglobin-haemoglobin complex. Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. Only protein-protein interactions imex curation hpt_pig Haptoglobin HP protein protein pig Sus scrofa (Pig) Pig MRALGAVVALLLCGQLFAAETGNEATDATDDSCPKPPEIPKGYVEHMVRYHCQTYYKLRTAGDGVYTLDSNKQWTNKVTGEKLPECEAVCGKPKNPVDQVQRIMGGSLDAKGSFPWQAKMISHHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYVGKKQEVEIEKVIFHPDNSTVDIGLIKLKQKVPVNERVMPICLPSKDYVNVGLVGYVSGWGRNANLNFTEHLKYVMLPVADQEKCVQYYEGSTVPEKKTPKSPVGVQPILNEHTFCAGLSKYQEDTCYGDAGSAFAVHDKDDDTWYAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIADN hba_pig Hemoglobin subunit alpha HBA Hemoglobin alpha chain Alpha-globin protein protein pig Sus scrofa (Pig) Pig VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQKVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPSVHASLDKFLANVSTVLTSKYR hbb_pig Hemoglobin subunit beta HBB Beta-globin Hemoglobin beta chain protein protein pig Sus scrofa (Pig) Pig MVHLSAEEKEAVLGLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKVKAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGHDFNPNVQAAFQKVVAGVANALAHKYH hba-hbb-12 3244425 N/A 3244429 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig N/A 3244430 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig N/A 3244431 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig physical association physical association false false false hba-hbb-13 3244426 N/A 3244429 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig N/A 3244430 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig N/A 3244431 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig association association false false false hba-hbb-14 3244427 N/A 3244429 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig N/A 3244430 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig N/A 3244431 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig direct interaction direct interaction false false false hba-hbb-15 3244428 N/A 3244429 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig N/A 3244430 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig N/A 3244431 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig physical association physical association false false false