DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nam-2012-3 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Nam KH., Haitjema C., Liu X., Ding F., Wang H., DeLisa MP., Ke A. DIP original experiment: DIP-250511X Structure (London, England : 1993) 2012 IMEx Cas5d protein processes pre-crRNA and assembles into a cascade-like interference complex in subtype I-C/Dvulg CRISPR-Cas system. Nam KH., Haitjema C., Liu X., Ding F., Wang H., DeLisa MP., Ke A. Only protein-protein interactions imex curation nam-2012-4 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Nam KH., Haitjema C., Liu X., Ding F., Wang H., DeLisa MP., Ke A. DIP original experiment: DIP-250513X Structure (London, England : 1993) 2012 IMEx Cas5d protein processes pre-crRNA and assembles into a cascade-like interference complex in subtype I-C/Dvulg CRISPR-Cas system. Nam KH., Haitjema C., Liu X., Ding F., Wang H., DeLisa MP., Ke A. Only protein-protein interactions imex curation nam-2012-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Nam KH., Haitjema C., Liu X., Ding F., Wang H., DeLisa MP., Ke A. DIP original experiment: DIP-250512X Structure (London, England : 1993) 2012 IMEx Cas5d protein processes pre-crRNA and assembles into a cascade-like interference complex in subtype I-C/Dvulg CRISPR-Cas system. Nam KH., Haitjema C., Liu X., Ding F., Wang H., DeLisa MP., Ke A. Only protein-protein interactions imex curation nam-2012-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nam KH., Haitjema C., Liu X., Ding F., Wang H., DeLisa MP., Ke A. DIP original experiment: DIP-250514X Structure (London, England : 1993) 2012 IMEx Cas5d protein processes pre-crRNA and assembles into a cascade-like interference complex in subtype I-C/Dvulg CRISPR-Cas system. Nam KH., Haitjema C., Liu X., Ding F., Wang H., DeLisa MP., Ke A. Only protein-protein interactions imex curation q9kfy3_alkhc BH0337 protein protein bachd Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) MRNEVQFELFGDYALFTDPLTKIGGEKLSYSVPTYQALKGIAESIYWKPTIVFVIDELRVMKPIQMESKGVRPIEYGGGNTLAHYTYLKDVHYQVKAHFEFNLHRPDLAFDRNEGKHYSILQRSLKAGGRRDIFLGARECQGYVAPCEFGSGDGFYDGQGKYHLGTMVHGFNYPDETGQHQLDVRLWSAVMENGYIQFPRPEDCPIVRPVKEMEPKIFNPDNVQSAEQLLHDLGGE q9kfy1_alkhc BH0339 protein protein bachd Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) MTILDHKIDFAVILSVTKANPNGDPLNGNRPRQNYDGHGEISDVAIKRKIRNRLLDMEEPIFVQSDDRKADSFKSLRDRADSNPELAKMLKAKNASVDEFAKIACQEWMDVRSFGQVFAFKGSNLSVGVRGPVSIHTATSIDPIDIVSTQITKSVNSVTGDKRSSDTMGMKHRVDFGVYVFKGSINTQLAEKTGFTNEDAEKIKRALITLFENDSSSARPDGSMEVHKVYWWEHSSKLGQYSSAKVHRSLKIESKTDTPKSFDDYAVELYELDGLGVEVIDGQ q9kfy2_alkhc BH0338 protein protein bachd Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) MSWLLHLYETYEANLDQVGKTVKKGEDREYTLLPISHTTQNAHIEVTLDEDGDFLRAKALTKESTLIPCTEEAASRSGSKVAPYPLHDKLSYVAGDFVKYGGKIKNQDDAPFDTYIKNLGEWANSPYATEKVKCIYTYLKKGRLIEDLVDAGVLKLDENQQLIEKWEKRYEELLGEKPAIFSSGATDQASAFVRFNVFHPESIDDVWKDKEMFDSFISFYNDKLGEEDICFVTGNRLPSTERHANKIRHAADKAKLISANDNSGFTFRGRFKTSREAVGISYEVSQKAHNALKWLIHRQSKSIDDRVFLVWSNDNSLVPNPDEDAVDIMKHANRELERDPDTGQIFAGEVKKAIGGYRSDLNYQPEVHILVLDSATTGRMAVLYYRSLNKELYLNRLEAWHDSCAWEHRYRRDEKEFISFYGAPATKDIAFAAYGPRASEKVIKDLMERMLPCIVDGRRVPKDIVRSAFQRASNPVSMERWEWEKTLSITCALIRKMHIEQKEEWGVPLDKSSTDRSYLFGRLLAVADVLERGALGKDETRATNAIRYMNSYSKNPGRTWKTIQESLQPYQAKLGTKATYLSKLVDEIGDQFEPGDFNNNPLTEQYLLGFYSQRRELYKKKEEETNQ q9kfy3_bachd-q9kfy1_bachd-1 3242998 N/A 3243002 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3243003 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3243004 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false q9kfy1_bachd-q9kfy2_bachd-1 3242999 N/A 3243002 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3243003 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3243004 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false q9kfy1_bachd-q9kfy2_bachd-2 3243000 N/A 3243002 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3243003 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3243004 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false q9kfy1_bachd-q9kfy2_bachd-3 3243001 N/A 3243002 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3243003 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3243004 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false