DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jiang-2012-4 human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jiang X., Liu H., Chen X., Chen PH., Fischer D., Sriraman V., Yu HN., Arkinstall S., He X. DIP original experiment: DIP-251730X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor. Jiang X., Liu H., Chen X., Chen PH., Fischer D., Sriraman V., Yu HN., Arkinstall S., He X. Only protein-protein interactions imex curation jiang-2012-5 human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jiang X., Liu H., Chen X., Chen PH., Fischer D., Sriraman V., Yu HN., Arkinstall S., He X. DIP original experiment: DIP-251731X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor. Jiang X., Liu H., Chen X., Chen PH., Fischer D., Sriraman V., Yu HN., Arkinstall S., He X. Only protein-protein interactions imex curation p23945-1 Follicle-stimulating hormone receptor FSHR LGR1 R1 Follitropin receptor protein protein human Homo sapiens Human MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTNGSTYILVPLSHLAQN fshb_human Follitropin subunit beta FSHB Follicle-stimulating hormone beta subunit Follitropin beta chain protein protein human Homo sapiens Human MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE glha_human Glycoprotein hormones alpha chain Anterior pituitary glycoprotein hormones common subunit alpha Follitropin alpha chain Follicle-stimulating hormone alpha chain Lutropin alpha chain Luteinizing hormone alpha chain Thyrotropin alpha chain Thyroid-stimulating hormone alpha chain Choriogonadotropin alpha chain Chorionic gonadotrophin subunit alpha CGA protein protein human Homo sapiens Human MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS cga-fshb-3 3242711 N/A 3242713 unspecified role unspecified role unspecified role unspecified role Region 16-366 Region 16-366 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3242714 unspecified role unspecified role unspecified role unspecified role Region 19-129 Region 19-129 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3242715 unspecified role unspecified role unspecified role unspecified role Region 25-116 Region 25-116 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false cga-fshb-4 3242712 N/A 3242713 unspecified role unspecified role unspecified role unspecified role Region 16-366 Region 16-366 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3242714 unspecified role unspecified role unspecified role unspecified role Region 19-129 Region 19-129 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3242715 unspecified role unspecified role unspecified role unspecified role Region 25-116 Region 25-116 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false