IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ howangyin-2012-1 human-m8 human M8 metastatic melanoma cell line Human m8 M8 metastatic melanoma cell line Provided by Dr F. Jotereau (INSERM U211, Nantes, France), electrophoresis electrophoretic mobility-based method electrophoresis western blot western blot Immuno blot Immuno blot HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J. It is not shown if B2M is present or not. From References 41 and 42 it has been assumed the HLA-G transfectants are full length. total proteins from M8 transfectants (lysates) were immunoprecipitated followed by non-reducing SDS-PAGE. Joel.LeMaoult@cea.fr Cellular and molecular life sciences : CMLS 2012 imex curation Only protein-protein interactions imex curation howangyin-2012-2 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J. Precleared cell lysates were incubated with Sepharose beads coated with LILRB2-Fc, followed by anti-HLA-G western blotting. From References 41 and 42 it has been assumed the HLA-G transfectants are full length. Joel.LeMaoult@cea.fr Cellular and molecular life sciences : CMLS 2012 imex curation Only protein-protein interactions imex curation howangyin-2012-4 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J. Joel.LeMaoult@cea.fr Cellular and molecular life sciences : CMLS 2012 imex curation Only protein-protein interactions imex curation howangyin-2012-3 in vitro In vitro affinity techniques affinity technology affinity techniques antibody detection identification by antibody antibody detection HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J. the methods section states that beads were coated with GST-HLA-G, but the image legend appears to state that beads were coated with LILRBs. HLA-G6- GST and control GST proteins were coated on Bio-Plex COOH beads (Bio-Rad) and incubated with LILRB. Binding to beads was detected by Flow Cytometry using a PE-conjugated Goat anti-human Fc antibody. Joel.LeMaoult@cea.fr Cellular and molecular life sciences : CMLS 2012 imex curation Only protein-protein interactions imex curation p17693-4 HLA class I histocompatibility antigen, alpha chain G HLA G antigen MHC class I antigen G HLA-G.3-5 HLA-G4 HLA-G HLA-6.0 HLAG protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRAKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD p17693-1 HLA class I histocompatibility antigen, alpha chain G HLA G antigen MHC class I antigen G HLA-G1 HLA-G HLA-6.0 HLAG protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD p17693-2 HLA class I histocompatibility antigen, alpha chain G HLA G antigen MHC class I antigen G HLA-G2 HLA-G HLA-6.0 HLAG protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEAKPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD p17693-5 HLA class I histocompatibility antigen, alpha chain G HLA G antigen MHC class I antigen G HLA-G1sol HLA-G5 HLA-6.0 HLAG HLA-G protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWSKEGDGGIMSVRESRSLSEDL lirb2_human Leukocyte immunoglobulin-like receptor subfamily B member 2 LILRB2 ILT4 LIR2 MIR10 CD85 antigen-like family member D Immunoglobulin-like transcript 4 Monocyte/macrophage immunoglobulin-like receptor 10 protein protein human Homo sapiens Human MTPIVTVLICLGLSLGPRTHVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH p17693-6 HLA class I histocompatibility antigen, alpha chain G HLA G antigen MHC class I antigen G HLA-G2sol HLA-G6 HLA-G HLA-6.0 HLAG protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEAKPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWSKEGDGGIMSVRESRSLSEDL isoform _g1-1 3134477 N/A 3134481 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Stoichiometry: 2.0 physical association physical association false false false 2B homodimers of HLA-G3 (alpha1 domain, lane 4) were never observed hla_g-2 3134477 N/A 3134482 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Stoichiometry: 2.0 physical association physical association false false false 2Bi homodimers of HLA-G3 (alpha1 domain, lane 4) were never observed hla_g_4-1 3134477 N/A 3134483 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Stoichiometry: 2.0 physical association physical association false false false 2Bii hla_g-11 3134477 N/A 3134484 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Stoichiometry: 2.0 physical association physical association false false false 2Bv hla_g-3 3134478 N/A 3134485 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3134482 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-m8 human M8 metastatic melanoma cell line Human m8 M8 metastatic melanoma cell line Provided by Dr F. Jotereau (INSERM U211, Nantes, France), physical association physical association false false false 3A lilrb2-hla_g-4 3134478 N/A 3134485 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3134483 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-m8 human M8 metastatic melanoma cell line Human m8 M8 metastatic melanoma cell line Provided by Dr F. Jotereau (INSERM U211, Nantes, France), physical association physical association false false false 3A-2 lilrb2-hla_g-6 3134478 N/A 3134485 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3134484 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-m8 human M8 metastatic melanoma cell line Human m8 M8 metastatic melanoma cell line Provided by Dr F. Jotereau (INSERM U211, Nantes, France), physical association physical association false false false 3A-3 lilrb2-hla_g-8 3134478 N/A 3134485 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3134486 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-m8 human M8 metastatic melanoma cell line Human m8 M8 metastatic melanoma cell line Provided by Dr F. Jotereau (INSERM U211, Nantes, France), physical association physical association false false false 3A-4 hla_g-lilrb2-1 3134479 N/A 3134485 unspecified role unspecified role bait bait human-nkl Homo sapiens nkl nkl N/A 3134486 unspecified role unspecified role prey prey purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3C hla_g-lilrb2-2 3134479 N/A 3134485 unspecified role unspecified role bait bait human-nkl Homo sapiens nkl nkl N/A 3134484 unspecified role unspecified role prey prey purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3Ci lilrb2-hla_g-5 3134480 N/A 3134485 unspecified role unspecified role unspecified role unspecified role region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3134486 unspecified role unspecified role unspecified role unspecified role purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3B