DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gregory-2012-1 human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Gregory AP., Dendrou CA., Attfield KE., Haghikia A., Xifara DK., Butter F., Poschmann G., Kaur G., Lambert L., Leach OA., Prömel S., Punwani D., Felce JH., Davis SJ., Gold R., Nielsen FC., Siegel RM., Mann M., Bell JI., McVean G., Fugger L. DIP original experiment: DIP-250755X Nature 2012 IMEx TNF receptor 1 genetic risk mirrors outcome of anti-TNF therapy in multiple sclerosis. Gregory AP., Dendrou CA., Attfield KE., Haghikia A., Xifara DK., Butter F., Poschmann G., Kaur G., Lambert L., Leach OA., Prömel S., Punwani D., Felce JH., Davis SJ., Gold R., Nielsen FC., Siegel RM., Mann M., Bell JI., McVean G., Fugger L. Only protein-protein interactions imex curation gregory-2012-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Gregory AP., Dendrou CA., Attfield KE., Haghikia A., Xifara DK., Butter F., Poschmann G., Kaur G., Lambert L., Leach OA., Prömel S., Punwani D., Felce JH., Davis SJ., Gold R., Nielsen FC., Siegel RM., Mann M., Bell JI., McVean G., Fugger L. DIP original experiment: DIP-250757X Nature 2012 IMEx TNF receptor 1 genetic risk mirrors outcome of anti-TNF therapy in multiple sclerosis. Gregory AP., Dendrou CA., Attfield KE., Haghikia A., Xifara DK., Butter F., Poschmann G., Kaur G., Lambert L., Leach OA., Prömel S., Punwani D., Felce JH., Davis SJ., Gold R., Nielsen FC., Siegel RM., Mann M., Bell JI., McVean G., Fugger L. Only protein-protein interactions imex curation gregory-2012-3 human Homo sapiens Human bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined Gregory AP., Dendrou CA., Attfield KE., Haghikia A., Xifara DK., Butter F., Poschmann G., Kaur G., Lambert L., Leach OA., Prömel S., Punwani D., Felce JH., Davis SJ., Gold R., Nielsen FC., Siegel RM., Mann M., Bell JI., McVean G., Fugger L. DIP original experiment: DIP-250756X Nature 2012 IMEx TNF receptor 1 genetic risk mirrors outcome of anti-TNF therapy in multiple sclerosis. Gregory AP., Dendrou CA., Attfield KE., Haghikia A., Xifara DK., Butter F., Poschmann G., Kaur G., Lambert L., Leach OA., Prömel S., Punwani D., Felce JH., Davis SJ., Gold R., Nielsen FC., Siegel RM., Mann M., Bell JI., McVean G., Fugger L. Only protein-protein interactions imex curation p19438-1 Tumor necrosis factor receptor superfamily member 1A Tumor necrosis factor receptor 1 Tumor necrosis factor receptor type I p55 p60 FL-TNFR1 TNFRSF1A TNFAR TNFR1 protein protein human Homo sapiens Human MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR tnfa_human Tumor necrosis factor TNF TNFA TNFSF2 TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin protein protein human Homo sapiens Human MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL tnfrsf1a-1 3242497 N/A 3242500 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Region 1-232 Region 1-232 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false EYFP-tag EYFP-tag eyfp enhanced yellow fluorescent protein tag eyfp c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3242500 unspecified role unspecified role fluorescence donor fluorescence donor ECFP-tag ECFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction false false false tnf-tnfrsf1a-7 3242498 N/A 3242501 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3242500 unspecified role unspecified role prey prey Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false Deletion of region 1-232 decreased the interaction rate/strength. tnfrsf1a-6 3242499 N/A 3242500 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3242500 unspecified role unspecified role fluorescence donor fluorescence donor RLuc-tag RLuc-tag renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction false false false