DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ roy-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Roy A., Bhardwaj A., Datta P., Lander GC., Cingolani G. DIP original experiment: DIP-250503X Structure (London, England : 1993) 2012 IMEx Small terminase couples viral DNA binding to genome-packaging ATPase activity. Roy A., Bhardwaj A., Datta P., Lander GC., Cingolani G. Only protein-protein interactions imex curation roy-2012-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Roy A., Bhardwaj A., Datta P., Lander GC., Cingolani G. DIP original experiment: DIP-250500X Structure (London, England : 1993) 2012 IMEx Small terminase couples viral DNA binding to genome-packaging ATPase activity. Roy A., Bhardwaj A., Datta P., Lander GC., Cingolani G. Only protein-protein interactions imex curation roy-2012-3 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Roy A., Bhardwaj A., Datta P., Lander GC., Cingolani G. DIP original experiment: DIP-250501X Structure (London, England : 1993) 2012 IMEx Small terminase couples viral DNA binding to genome-packaging ATPase activity. Roy A., Bhardwaj A., Datta P., Lander GC., Cingolani G. Only protein-protein interactions imex curation roy-2012-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Roy A., Bhardwaj A., Datta P., Lander GC., Cingolani G. DIP original experiment: DIP-250502X Structure (London, England : 1993) 2012 IMEx Small terminase couples viral DNA binding to genome-packaging ATPase activity. Roy A., Bhardwaj A., Datta P., Lander GC., Cingolani G. Only protein-protein interactions imex curation ters_bpp22 Terminase, small subunit 3 DNA-packaging protein gp3 protein protein bpp22 Salmonella phage P22 Bacteriophage P22 MAAPKGNRFWEARSSHGRNPKFESPEALWAACCEYFEWVEANPLWEMKAFSYQGEVIQEPIAKMRAMTITGLTLFIDVTLETWRTYRLREDLSEVVTRAEQVIYDQKFSGAAADLLNANIIARDLGLKEQSQVEDVTPDKGDRDKRRSRIKELFNRGTGRDS terl_bpp22 Terminase, large subunit 2 DNA-packaging protein gp2 protein protein bpp22 Salmonella phage P22 Bacteriophage P22 MELDAILDNLSDEEQIELLELLEEEENYRNTHLLYEFAPYSKQREFIDAGHDYPERCFMAGNQLGKSFTGAAEVAFHLTGRYPGTKGYPADGKYGGEWKGKRFYEPVVFWIGGETNETVTKTTQRILCGRIEENDEPGYGSIPKEDIISWKKSPFFPNLVDHLLVKHHTADGVEDGISICYFKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTKFLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGAVKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNSVESGISELRDLMLEGRFKVFNTCEPFFEEFRLYHRDENGKIVKTNDDVLDATRYGYMMRRFARMMRDIRKPKEKKIPAPIRPVRRGR 3-1 3242263 N/A 3242267 unspecified role unspecified role unspecified role unspecified role Region 1-139 Region 1-139 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 3-2 3242264 N/A 3242267 unspecified role unspecified role unspecified role unspecified role Region 1-139 Region 1-139 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 3-3 3242265 N/A 3242267 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 2-3 3242266 N/A 3242268 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3242267 unspecified role unspecified role unspecified role unspecified role Region 140-162 Region 140-162 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false