DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ petukhov-2012-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Petukhov M., Dagkessamanskaja A., Bommer M., Barrett T., Tsaneva I., Yakimov A., Quéval R., Shvetsov A., Khodorkovskiy M., Käs E., Grigoriev M. DIP original experiment: DIP-250499X Structure (London, England : 1993) 2012 IMEx Large-scale conformational flexibility determines the properties of AAA+ TIP49 ATPases. Petukhov M., Dagkessamanskaja A., Bommer M., Barrett T., Tsaneva I., Yakimov A., Quéval R., Shvetsov A., Khodorkovskiy M., Käs E., Grigoriev M. Only protein-protein interactions imex curation ruvb2_human RuvB-like 2 RUVBL2 TIP48 TIP49B CGI-46 48 kDa TATA box-binding protein-interacting protein TIP49b Repressing pontin 52 51 kDa erythrocyte cytosolic protein INO80J TIP60-associated protein 54-beta INO80 complex subunit J protein protein human Homo sapiens Human MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS ruvbl2-6 3242046 N/A 3242047 unspecified role unspecified role unspecified role unspecified role Region 1-130/242-463 Region 1-130/242-463 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false