DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nakamura-2012-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nakamura T., Liu YJ., Nakashima H., Umehara H., Inoue K., Matoba S., Tachibana M., Ogura A., Shinkai Y., Nakano T. DIP original experiment: DIP-250644X Nature 2012 IMEx PGC7 binds histone H3K9me2 to protect against conversion of 5mC to 5hmC in early embryos. Nakamura T., Liu YJ., Nakashima H., Umehara H., Inoue K., Matoba S., Tachibana M., Ogura A., Shinkai Y., Nakano T. Only protein-protein interactions imex curation h3k9-2 Histone H3 N-terminal Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQLA dppa3_mouse Developmental pluripotency-associated protein 3 Dppa3 Cap1p Crg1 Pgc7 Compaction-associated protein 1 Primordial germ cell protein 7 protein protein mouse Mus musculus Mouse MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN h3 (121)-dppa3-1 3241440 N/A 3241441 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false in vitro In vitro N/A 3241442 unspecified role unspecified role prey prey N-terminal domain Region 1-75 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false