IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ huang-2012-42 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Histochemistry and cell biology 2012 imex curation Only protein-protein interactions imex curation huang-2012-39 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Human full-length cDNA library Histochemistry and cell biology 2012 imex curation Only protein-protein interactions imex curation huang-2012-40 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Histochemistry and cell biology 2012 imex curation Only protein-protein interactions imex curation huang-2012-41 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Histochemistry and cell biology 2012 imex curation Only protein-protein interactions imex curation huang-2012-43 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Histochemistry and cell biology 2012 imex curation Only protein-protein interactions imex curation huang-2012-44 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Histochemistry and cell biology 2012 imex curation Only protein-protein interactions imex curation tad2a_human Transcriptional adapter 2-alpha TADA2A TADA2L Transcriptional adapter 2-like KL04P protein protein human Homo sapiens Human MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPSIPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG cc134_human Coiled-coil domain-containing protein 134 CCDC134 protein protein human Homo sapiens Human MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL tada3_human Transcriptional adapter 3 ADA3 homolog STAF54 TADA3 ADA3 TADA3L Transcriptional adapter 3-like protein protein human Homo sapiens Human MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG ccdc134-tada2a-2 3315042 N/A 3315048 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3315049 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2A-2 tada3-ccdc134-1 3315042 N/A 3315050 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3315048 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3315049 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 4A ccdc134-tada2a-5 3315043 N/A 3315048 unspecified role unspecified role prey prey N/A 3315049 unspecified role unspecified role bait bait physical association physical association false false false Supp fig 1A ccdc134-tada2a-1 3315044 N/A 3315048 unspecified role unspecified role prey prey N/A 3315049 unspecified role unspecified role bait bait physical association physical association false false false Supp fig 1B tada2a-ccdc134-3 3315045 N/A 3315048 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3315049 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2A ccdc134-tada2a-3 3315046 N/A 3315048 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3315049 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 2B ccdc134-tada2a-4 3315047 N/A 3315048 unspecified role unspecified role neutral component neutral component N/A 3315049 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2C, 5D UV irradiation