DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pobbati-2012-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250464X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions imex curation pobbati-2012-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250466X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions imex curation pobbati-2012-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250462X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions imex curation pobbati-2012-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250463X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions imex curation pobbati-2012-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pobbati AV., Chan SW., Lee I., Song H., Hong W. DIP original experiment: DIP-250465X Structure (London, England : 1993) 2012 IMEx Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Pobbati AV., Chan SW., Lee I., Song H., Hong W. Only protein-protein interactions imex curation vgll1_mouse Transcription cofactor vestigial-like protein 1 Vgll1 Vestigial-related factor protein protein mouse Mus musculus Mouse MEEMKKNGVWIPESSQKPVKTEWNAGSVIFTYFEGDINSMVDEHFSRALRNLKRPHKCSSSSHSDNLTLKNGVNKTRTDTSHTDRERKVESSQTENSGELKDVPVEEKGTNKSMPPNQRHLSSWTIAQPAASPENGARSSSLDEYGLKAMDQHSLSMPKTPSALPLEPWHFSSLARPGFIAPAYFPVFPDRHLTPEVYRVFPDRHLTPEVYHVFPDRHLTPEVYPDGRCGPLQHLVQQDRYQNHPLEPAARENCSPAKIAGSTGSLMNLPPYPVHYKKKICARGAASASLDDERSPSPKRRRDAYYY q62296-1 Transcriptional enhancer factor TEF-3 Tead4 Tcf13r1 Tef3 Tefr1 TEFR1A ETFR-2A ETF-related factor 2 TEA domain family member 4 TEF-1-related factor 1 TEF-1-related factor FR-19 protein protein mouse Mus musculus Mouse MTSNEWSSPDSPEGSSISGGSQALDKPIDNDAEGVWSPEIERSFQEALAIYPPCGRRKIILTEEGKMYGRNELIARHIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGYPAISGFWQGALPGQPGTSHDVKPFSQNTYPVQPPLPLPGFESPAGPTPSPSAPLAPPWQGRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL tead4-vgll1-3 3240748 N/A 3240753 unspecified role unspecified role prey prey Q99NC0:p.[His44Ala;Phe45Ala] H44A/F45A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3240754 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false tead4-yap1-4 3240749 N/A 3240755 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3240754 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false tead4-vgll1-4 3240750 N/A 3240753 unspecified role unspecified role unspecified role unspecified role Region 20-56 Region 20-56 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3240754 unspecified role unspecified role unspecified role unspecified role C-terminal Region 210-427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tead4-vgll1-5 3240751 N/A 3240753 unspecified role unspecified role unspecified role unspecified role Region 20-56 Region 20-56 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3240754 unspecified role unspecified role unspecified role unspecified role C-terminal Region 210-427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tead4-vgll1-6 3240752 N/A 3240753 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3240754 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false