DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ eigenbrot-2012-1 trini Trichoplusia ni (Cabbage looper) Cabbage looper saxs x ray scattering saxs predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250457X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions imex curation eigenbrot-2012-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250454X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions imex curation eigenbrot-2012-3 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250458X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions imex curation eigenbrot-2012-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250455X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions imex curation eigenbrot-2012-5 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250460X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions imex curation eigenbrot-2012-6 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250456X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions imex curation eigenbrot-2012-7 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250459X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions imex curation eigenbrot-2012-8 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250461X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions imex curation htra1_human Serine protease HTRA1 HTRA1 HTRA PRSS11 High-temperature requirement A serine peptidase 1 L56 Serine protease 11 protein protein human Homo sapiens Human MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP igf1_human Insulin-like growth factor I IGF1 IBP1 Somatomedin-C Mechano growth factor protein protein human Homo sapiens Human MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation mint ibp1_human Insulin-like growth factor-binding protein 1 IGFBP1 IBP1 Placental protein 12 protein protein human Homo sapiens Human MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN p01344-1 Insulin-like growth factor II IGF2 Somatomedin-A T3M-11-derived growth factor PP1446 protein protein human Homo sapiens Human MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Product of 5 different transcripts regulated by 5 different promoters, denominated P0, P1, P2, P3 and P4. ibp3_human Insulin-like growth factor-binding protein 3 IGFBP3 IBP3 protein protein human Homo sapiens Human MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK htra1-7 3240021 N/A 3240029 unspecified role unspecified role unspecified role unspecified role Mature protein Region 23-480 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false htra1-8 3240022 N/A 3240029 unspecified role unspecified role unspecified role unspecified role Catalytic domain Region 161-379 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false igf1-igfbp1-2 3240023 N/A 3240030 unspecified role unspecified role bait bait Region 49-118 Region 49-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3240031 unspecified role unspecified role prey prey Region 26-259 Region 26-259 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse direct interaction direct interaction false false false htra1-9 3240024 N/A 3240029 unspecified role unspecified role unspecified role unspecified role Catalytic domain Region 161-379 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false igf2-igfbp1-1 3240025 N/A 3240032 unspecified role unspecified role bait bait Region 25-91 Region 25-91 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3240031 unspecified role unspecified role prey prey Region 26-259 Region 26-259 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse direct interaction direct interaction false false false htra1-10 3240026 N/A 3240029 unspecified role unspecified role unspecified role unspecified role Region 23-376 Region 23-376 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false igf1-igfbp3-1 3240027 N/A 3240030 unspecified role unspecified role bait bait Region 49-118 Region 49-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3240033 unspecified role unspecified role prey prey Region 28-291 Region 28-291 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse direct interaction direct interaction false false false igf2-igfbp3-1 3240028 N/A 3240033 unspecified role unspecified role prey prey Region 28-291 Region 28-291 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3240032 unspecified role unspecified role bait bait Region 25-91 Region 25-91 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false