DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ melero-2012-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250952X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-2 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250960X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250953X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250954X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-5 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250956X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-6 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250959X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-7 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250957X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-8 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250958X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-9 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250955X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation melero-2012-10 in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation weight by comassie molecular weight estimation by coomasie staining weight by comassie Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. DIP original experiment: DIP-250961X Nature structural & molecular biology 2012 IMEx The cryo-EM structure of the UPF-EJC complex shows UPF1 poised toward the RNA 3' end. Melero R., Buchwald G., Castaño R., Raabe M., Gil D., Lázaro M., Urlaub H., Conti E., Llorca O. Only protein-protein interactions imex curation q9y5s9-1 RNA-binding protein 8A RBM8A Binder of OVCA1-1 RBM8 RNA-binding motif protein 8A RNA-binding protein Y14 Ribonucleoprotein RBM8A HSPC114 MDS014 BOV-1a protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR casc3_human Protein CASC3 CASC3 MLN51 Cancer susceptibility candidate gene 3 protein Metastatic lymph node gene 51 protein Protein barentsz protein protein human Homo sapiens Human MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALHLRRVESGGAKSAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYRSRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS mgn_human Protein mago nashi homolog MAGOH MAGOHA protein protein human Homo sapiens Human MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI if4a3_human Eukaryotic initiation factor 4A-III KIAA0111 EIF4A3 DDX48 Eukaryotic translation initiation factor 4A isoform 3 ATP-dependent RNA helicase eIF4A-3 ATP-dependent RNA helicase DDX48 DEAD box protein 48 Eukaryotic initiation factor 4A-like NUK-34 Nuclear matrix protein 265 protein protein human Homo sapiens Human MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI q9bzi7-2 Regulator of nonsense transcripts 3B UPF3B RENT3B UPF3X Nonsense mRNA reducing factor 3B Up-frameshift suppressor 3 homolog B Up-frameshift suppressor 3 homolog on chromosome X protein protein human Homo sapiens Human MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVEFAPFQKAAKKKTKKRDTKVGTIDDDPEYRKFLESYATDNEKMTSTPETLLEEIEAKNRELIAKKTTPLLSFLKNKQRMREEKREERRRREIERKRQREEERRKWKEEEKRKRKDIEKLKKIDRIPERDKLKDEPKIKLLKKPEKGDEKELDKREKAKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEGGEE rent2_human Regulator of nonsense transcripts 2 Nonsense mRNA reducing factor 2 Up-frameshift suppressor 2 homolog UPF2 KIAA1408 RENT2 protein protein human Homo sapiens Human MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVSKAPEDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQMKEKEESIQLHQEAWERHHLRKELRSKNQNAPDSRPEENFFSRLDSSLKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPAILFKDNEKSCQNKESNKDDTKEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEAEDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKDSKDSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLTDSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR rent1_human Regulator of nonsense transcripts 1 UPF1 RENT1 KIAA0221 ATP-dependent helicase RENT1 Nonsense mRNA reducing factor 1 Up-frameshift suppressor 1 homolog protein protein human Homo sapiens Human MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY casc3-eif4a3-11 3239674 N/A 3239684 unspecified role unspecified role unspecified role unspecified role RRM domain Region 66-154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239685 unspecified role unspecified role unspecified role unspecified role Region 137-286 Region 137-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239686 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239687 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239688 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239690 unspecified role unspecified role unspecified role unspecified role Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false casc3-eif4a3-12 3239675 N/A 3239684 unspecified role unspecified role unspecified role unspecified role RRM domain Region 66-154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239685 unspecified role unspecified role unspecified role unspecified role Region 137-286 Region 137-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239686 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239687 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239688 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239690 unspecified role unspecified role unspecified role unspecified role Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false casc3-eif4a3-13 3239676 N/A 3239684 unspecified role unspecified role unspecified role unspecified role RRM domain Region 66-154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239685 unspecified role unspecified role unspecified role unspecified role Region 137-286 Region 137-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239686 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239687 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239688 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false upf1-upf2-14 3239677 N/A 3239688 unspecified role unspecified role unspecified role unspecified role RRM domain Region 42-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239690 unspecified role unspecified role unspecified role unspecified role Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false upf2-upf3b-1 3239678 N/A 3239688 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false upf1-upf2-15 3239679 N/A 3239688 unspecified role unspecified role unspecified role unspecified role RRM domain Region 42-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239690 unspecified role unspecified role unspecified role unspecified role Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false casc3-eif4a3-14 3239680 N/A 3239684 unspecified role unspecified role unspecified role unspecified role RRM domain Region 66-154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239685 unspecified role unspecified role unspecified role unspecified role Region 137-286 Region 137-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239686 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239687 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239688 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239690 unspecified role unspecified role unspecified role unspecified role Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false casc3-eif4a3-15 3239681 N/A 3239684 unspecified role unspecified role unspecified role unspecified role RRM domain Region 66-154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239685 unspecified role unspecified role unspecified role unspecified role Region 137-286 Region 137-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239686 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239687 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239688 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false upf2-upf3b-2 3239682 N/A 3239688 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false casc3-eif4a3-16 3239683 N/A 3239685 unspecified role unspecified role unspecified role unspecified role Region 137-286 Region 137-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239686 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239687 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239688 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239689 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3239690 unspecified role unspecified role unspecified role unspecified role Region 115-914 Region 115-914 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false