DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ elliott-2012-1 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252348X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-2 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252354X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-3 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252359X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-4 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252349X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-5 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252355X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252350X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-7 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252360X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-8 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252351X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-9 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252356X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-10 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252352X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-11 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252361X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-12 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252357X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-13 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252358X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation elliott-2012-14 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. DIP original experiment: DIP-252353X Structure (London, England : 1993) 2012 IMEx Asymmetric mode of Ca²⁺-S100A4 interaction with nonmuscle myosin IIA generates nanomolar affinity required for filament remodeling. Elliott PR., Irvine AF., Jung HS., Tozawa K., Pastok MW., Picone R., Badyal SK., Basran J., Rudland PS., Barraclough R., Lian LY., Bagshaw CR., Kriajevska M., Barsukov IL. Only protein-protein interactions imex curation s10a4_human Protein S100-A4 S100 calcium-binding protein A4 Metastasin Protein Mts1 Placental calcium-binding protein Calvasculin S100A4 CAPL MTS1 protein protein human Homo sapiens Human MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK myh9_human Myosin-9 MYH9 Myosin heavy chain 9 Myosin heavy chain, non-muscle IIa Non-muscle myosin heavy chain IIa Cellular myosin heavy chain, type A Non-muscle myosin heavy chain A protein protein human Homo sapiens Human MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE myh9-s100a4-2 3238959 N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1761-1960 Region 1761-1960 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false myh9-s100a4-3 3238960 N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1868-1938 Region 1868-1938 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false myh9-5 3238961 N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1761-1960 Region 1761-1960 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false s100a4-4 3238962 N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false myh9-s100a4-4 3238963 N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1868-1938 Region 1868-1938 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false s100a4-5 3238964 N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false myh9-s100a4-5 3238965 N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1897-1935 Region 1897-1935 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false s100a4-6 3238966 N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false myh9-s100a4-6 3238967 N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1897-1935 Region 1897-1935 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false s100a4-myh9-1 3238968 N/A 3238974 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3238973 unspecified role unspecified role bait bait P26447:p.Val77Asp V77D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P26447:p.Cys81Asp C81D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false myh9-s100a4-7 3238969 N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1897-1935 Region 1897-1935 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P35579:p.Phe1928Trp F1928W mutation mutation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false myh9-s100a4-8 3238970 N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1897-1935 Region 1897-1935 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false s100a4-myh9-2 3238971 N/A 3238974 unspecified role unspecified role prey prey Region 1897-1935 Region 1897-1935 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3238973 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false myh9-s100a4-9 3238972 N/A 3238974 unspecified role unspecified role unspecified role unspecified role Region 1868-1938 Region 1868-1938 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3238973 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false