DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2012-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. DIP original experiment: DIP-250882X Nature structural & molecular biology 2012 IMEx Structure of N-terminal domain of ZAP indicates how a zinc-finger protein recognizes complex RNA. Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. Only protein-protein interactions imex curation chen-2012-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. DIP original experiment: DIP-250886X Nature structural & molecular biology 2012 IMEx Structure of N-terminal domain of ZAP indicates how a zinc-finger protein recognizes complex RNA. Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. Only protein-protein interactions imex curation chen-2012-5 in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. DIP original experiment: DIP-250883X Nature structural & molecular biology 2012 IMEx Structure of N-terminal domain of ZAP indicates how a zinc-finger protein recognizes complex RNA. Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. Only protein-protein interactions imex curation chen-2012-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. DIP original experiment: DIP-250885X Nature structural & molecular biology 2012 IMEx Structure of N-terminal domain of ZAP indicates how a zinc-finger protein recognizes complex RNA. Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. Only protein-protein interactions imex curation chen-2012-7 rat Rattus norvegicus (Rat) Rat anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. DIP original experiment: DIP-250884X Nature structural & molecular biology 2012 IMEx Structure of N-terminal domain of ZAP indicates how a zinc-finger protein recognizes complex RNA. Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. Only protein-protein interactions imex curation chen-2012-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. DIP original experiment: DIP-250887X Nature structural & molecular biology 2012 IMEx Structure of N-terminal domain of ZAP indicates how a zinc-finger protein recognizes complex RNA. Chen S., Xu Y., Zhang K., Wang X., Sun J., Gao G., Liu Y. Only protein-protein interactions imex curation zcchv_rat Zinc finger CCCH-type antiviral protein 1 Zc3hav1 Zap ADP-ribosyltransferase diphtheria toxin-like 13 Zinc finger antiviral protein Inactive Poly [ADP-ribose] polymerase 13 protein protein rat Rattus norvegicus (Rat) Rat MADPGVCCFITKILCAHGGRMTLEELLGEIRLPEAQLYELLETAGPDRFVLLETGGQAGITRSVVATTRARVCRRKYCQRPCDSLHLCKLNLLGRCHYAQSQRNLCKYSHDVLSEQNFQILKNHELSGLNQEELACLLVQSDPFFLPEICKSYKGEGRKQTCGQPQPCERLHICEHFTRGNCSYLNCLRSHNLMDRKVLTIMREHGLSPDVVQNIQDICNNKHARRNPPGTRAAHPHRRGGAHRDRSKSRDRFLHNSLEFLSPVVSPLGSGPPSPDVTSCKDSLEDVSVDVTQKFKYLGTHDRAQLSPVSSKAAGVQGPSQMRASQEFSEDGNLDDIFSRNRSDSSSSRASAAKVAQRNEAVAMKMGMEVKGKKEAPDIDRVPFLNSYIDGVTMEKASVSGIPGKKFTANDLENLLLLNDTWKNVAKPQDLQTTGRITDSGQDKAFLQNKYGGNPVWASASTHNAPNGSSQIMDETPNVSKSSTSGFAIKPAIAGGKEAVYSGVQSPRSQVLAVPGEATTPVQSNRLPQSPLSSSSHRAAASGSPGKNSTHTSVSPAIESSRMTSDPDEYLLRYILNPLFRMDNHGPKEICQDHLYKGCQQSHCDRSHFHLPYRWQMFVYTTWRDFQDMESIEQAYCDPHVELILIENHQINFQKMTCDSYPIRRLSTPSYEEKPLSAVFATKWIWYWKNEFNEYIQYGNESPGHTSSDINSAYLESFFQSCPRGVLPFQAGSQKYELSFQGMIQTNIASKTQRHVVRRPVFVSSNDVEQKRRGPE parn_human Poly(A)-specific ribonuclease PARN PARN Polyadenylate-specific ribonuclease Deadenylating nuclease Deadenylation nuclease DAN protein protein human Homo sapiens Human MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW exos5_human Exosome complex component RRP46 EXOSC5 CML28 RRP46 Ribosomal RNA-processing protein 46 Exosome component 5 p12B Chronic myelogenous leukemia tumor antigen 28 protein protein human Homo sapiens Human MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS ddx17_human Probable ATP-dependent RNA helicase DDX17 DEAD box protein 17 RNA-dependent helicase p72 DEAD box protein p72 DDX17 DEAD box protein p82 protein protein human Homo sapiens Human MPTGFVAPILCVLLPSPTREAATVASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQALPSPAIRAPLPDLYPFGTMRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK zc3hav1-1 3237885 N/A 3237891 unspecified role unspecified role unspecified role unspecified role Region 1-225 Region 1-225 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false parn-zc3hav1-2 3237886 N/A 3237892 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3237891 unspecified role unspecified role prey prey Region 1-254 Region 1-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false zc3hav1-3 3237887 N/A 3237891 unspecified role unspecified role unspecified role unspecified role Region 1-225 Region 1-225 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false exosc5-zc3hav1-6 3237888 N/A 3237891 unspecified role unspecified role prey prey Region 1-254 Region 1-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3237893 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false zc3hav1-zc3hav1-1 3237889 N/A 3237891 unspecified role unspecified role prey prey Region 1-254 Region 1-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1-10 Region 1-10 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q8K3Y6:p.Glu133Ala E133A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false rat Rattus norvegicus (Rat) Rat N/A 3237891 unspecified role unspecified role bait bait Region 1-254 Region 1-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1-10 Region 1-10 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q8K3Y6:p.Glu133Ala E133A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false rat Rattus norvegicus (Rat) Rat physical association physical association false false false ddx17-zc3hav1-4 3237890 N/A 3237894 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3237891 unspecified role unspecified role prey prey Region 1-254 Region 1-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false