DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kuo-2012-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249530X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249540X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249537X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-4 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249533X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249534X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-6 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249535X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-7 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249538X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249532X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-9 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249536X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-10 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249539X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-11 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249531X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation kuo-2012-12 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. DIP original experiment: DIP-249541X Nature 2012 IMEx The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome. Kuo AJ., Song J., Cheung P., Ishibe-Murakami S., Yamazoe S., Chen JK., Patel DJ., Gozani O. Only protein-protein interactions imex curation orc5_human Origin recognition complex subunit 5 ORC5 ORC5L protein protein human Homo sapiens Human MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVFVNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTVYIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFPDYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIARTVNFDIIKYLYDFL orc3_human Origin recognition complex subunit 3 ORC3 LATHEO Origin recognition complex subunit Latheo ORC3L protein protein human Homo sapiens Human MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSNNQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELRRSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALHTALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC orc2_human Origin recognition complex subunit 2 ORC2 ORC2L protein protein human Homo sapiens Human MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA orc1_human Origin recognition complex subunit 1 ORC1 ORC1L PARC1 Replication control protein 1 protein protein human Homo sapiens Human MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPACDSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELGNLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETGLSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE h4(1129) Histone H4 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GKGGAKRHRKVLRDNIQGI orc1_drome Origin recognition complex subunit 1 Orc1 CG10667 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVNKENARSVGQQVKWIGSQDELPPVKNLEHKNVYFYQKCIYGPLTLSVGDFILVSNADAAEPDTVSGCDVARILHMYELRELTDREPCRAIVQWYSWPKAIPHNKYDDDEVAIDFSLEVIEEHRPYDNDVALGAIYRKCIVLEGTSKTSAEEILKRHANKLKSTACPMFVSRYRFVKVKRSYRLIPLEIHLEQPEDNARPTRSSRKSLTAHRESKRSISARHDDTAGNKGSSVEKRRRASMAASSSVEFIDVNSFICENKVSPIKIVGGRSVVRLSEKKNAPEINANYLPASPLTEKNAKVETPKSRASAARRNLNLSLDRGADTTADSDCLNYSIVQQTPDPKTPSNDMKIKLRLSERRRSVRLASMDVDPLSLEEAVQEPNAQGRKRLGVANGDIYHTPTKKSKEPLESAAATEQTPSTRRKSILKSATSRLAEGTPRRSIHLSNIVEQRVFEDDEIISTPKRGRSKKTVQDNDEDYSPKKSVQKTPTRTRRSSTTTKTATTPSKGITTATATPMTPSQKMKKIRAGELSPSMQQRTDLPAKDSSKSELQLAREQLHVSVVPKSLPCREREFENIYAFLEGKIQDQCGGCMYVSGVPGTGKTATVTGVIRTLQRMAKQNELPAFEYLEINGMRLTEPRQAYVQIYKQLTGKTVSWEQAHALLEKRFTTPAPRRVTTVLLVDELDILCNRRQDVVYNLLDWPTKSAAKLVVVTIANTMDLPERLLMGKVTSRLGLTRLTFQPYSHKQLQEIVTARLGGSETFKGEAVQLVARKVAAVSGDARRALDICRRATEIADTAAVKCVTMLHVQQALAEMIASAKVQAIRNCSRMEQIFLQAIAAEVTRTGVEETTFMGVYQQVETIAAFMGVTFPPPGRALRLCSKLGAERLIISEHSRNDLFQKILLNVSADDIHYALRVEEMVN orc1_mouse Origin recognition complex subunit 1 Orc1 Orc1l protein protein mouse Mus musculus Mouse MPSYLTRQKTRQTFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKPYVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIFWYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKKDFAPLPPEVLAALREQEDSPEWQKPLKAKIKNVKSPARNTTEQEVKGIKSNHSTSKFHQTPANIVIPNAKKSLELDGLGFTRKPNTRWSKKSSCDSLDYQKTSKRRAAFSETTSPPKKPNKPREIKPSSALETRVKNGQTQPFCAKSSVVLRARNPAMTTTKLGVDNTLSPIRNGLRSSVVPSGGLTPVYIRRKAKEQETHKEPIRTSRVHRKSSLLTLKRIRQQLCLLDGDDRDQEEEESVDSESEEEDEFISSLPTRNSLGQSRTRQTPSKSPQKNPKPRTPHRATPQIRDRNLAVQEPASALEEARLRLHVSAVPDSLPCREQEFQDIYSFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRCLQQAAETDDVPPFQYVEVNGMKLTEPHQVYVQILKKLTGQKATANHAAELLAKQFCGQGSQKETTVLLVDELDLLWTHKQDVMYNLFDWPTHKGAHLIVLTIANTMDLPERIMMNRVSSRLGLTRMSFQPYSHSQLKQILVSRLRNLRAFEDDAIQLVARKVAALSGDARRCLDICRRATEICELSHLRGDSLSLVTVAHLMEAIDEMFSSSYITAIKNSSVVEQSFLRAIIAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSRLGSCRLLLVEPSRNDLLLRVRLNVSQNDVLFALKEE orc1_bovin Origin recognition complex subunit 1 ORC1 ORC1L protein protein bovin Bos taurus (Bovine) Bovine MAYYSARLRTRQTYSWVGRPLLDQKLHYQTYKEMSMKREDYSTEIHIQVGQFVLIEGDDDENPYVAKLVELFEDDSELYSKKRARVQWFIRFCEVPVCKQHLLGRKPGTQEIFWYDNPTCNSNISVETIIGSVRVVALAPDEVMPIDLKNKKTFFVKLSWNEKKFKPLPPEVFAQLNKLQEDNHRYQKPMQAKTKSAESPSWTTTEHAVKRIESRHSTSKSRHTASHPVTPRARKRLELSSFPRTPNTRISPAASCASLDSPGRMKRKVAFSEVMSPSKRSLPDGFQTSSPALKAPEKTGEIQHSCTKDAKKTSPDHGMILRARAPALKITETSEERTLTPIGGGRKSSVVPSVILKPEYIKRREGKEPEVQDEAPSTSRIRRKSSVLTLNRIRQQLRFLGNSKSDENDEEFLPAAEISDCDSEEEEASTTPLPRRTPNSVSRNLRSSMKSSLQTPSKTPKKTPEPRTPRDATPRIRSRNLTAQGPTNMLEEARLRLHVAAVPESLPCREQEFQDIYNFVESKLLDQTGGCMYISGVPGTGKTATVHEVICCLQQAAQANEVPPFQYIEVNGMKLTEPHQVYVQILQKLTGKRATANHAAALLAKRFCTQGSSQETTVLLVDELDLLWTQKQDVMYNLFDWPTHKEARLVVLTIANTMDLPERIMMNRVSSRLGLTRMCFQPYTHSQLRQILLSRLRHVKAFEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSCQKPDSPGLVTTAHLLEAIDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQVYIQHVALCRMEGLPYPTMSETMAVCSRLGACRLLLVEPSRNDVLRRVRLNVSQDDVLYALKEE p70049_xenla Origin recognition complex subunit 1 orc1 orc1.L XORC1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MTKYFTRVKKHRVYAWKGRPSIKDRKLLNLHYGGLDIKSEGIGCITVTPGDFVLIEGENEERPFVAKLQELYDDGNEKHTSKHAIVQWFLRYEEVPYKKRALLGREPHQEEIFLYDVPSCENDIDAETIIGSVKVTQLKPGENFPVEKDAGILFVKLAWNGKAFKPLTSSICHKYGEIAANNHLEDHNSLPKPLFYPLEGDTAEIKQITRSATRGQRNEAEVESRHSASKSSHCKERGIQRVSSTTSTPGARKKLQLSSPTKSEVSSLEQEDTTLDEEFKMLESIAPKRKVAFSGIPDSPPKKVLSDIPNSASILPLKGNANSQTRLRLRLTPLRLPLEQSCSSLPENQSKNCIEVNGNKAVDNGRPVKSKTPQKLEPTPKKGTSRPLKRSEEDFEGDPQTPRSRRTSARKTANKVRAQLKALMDSDDDVDEDKDFVPIKETCTPSDSEEENEQEEVPLKRNVKRGCATPRTPTSSRKTSSRTPNKTPTSKTPHSATPRIPERNQPVKKPSNMLEEARIRLHVSAVPESLPCREQEYQDVYNFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRSLQESAEEEELPMFHYIEINGMKLTDPHQAYVQILKLLTGQKATADHAAALLEKRFSTPASKKETTVLLVDELDLLWTRKQNVMYSLFDWPTRKQAKLIVLAIANTMDLPERIMMNRVASRLGLTRMSFQPYTHKQLQQIITSRLNHIKAFDDDAIQLVARKVAALSGDARRCLDICRRATEICEFSHSMADSSLVKMSHVIEALEEMFSSPYVTAIRNSSLMEQTFLRAVIAEFRRSGLEEATFQQIYRQHVALCRIEGLQPPQMSETMAVCHRLGASRLLLVESSRNDLHLRVRINVSQDDIMYALKEE 6B449D9733487219 h4_bovin Histone H4 H4.1 protein protein bovin Bos taurus (Bovine) Bovine MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling mint q7zyw6_danre Origin recognition complex subunit 1 orc1 orc1l protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSRYITRLSMRRTYKWNGRPVGEDRKLRRQYYGSMSISVDGRTEDVTVSLGQYILIEGENDDNPYVAQLLKLYTDGKMKTAVVQWFVRICEVPQYKRKLLGRDPHPQEVFFYQDSSCDNEVDGESILAPVQIMYIAPEHPFPEGKSKDMLFVKHSWDTKSFQAVDPELIEPPPSPKSPPPSSRGPQARPLPTPDPSIMKRAITGAITRGSMSTGKMSSTEAESLHSASKLSAAKALSAKRRSRASSGPHVRKKLELCSPSKNMSRDDVLGEILDKHIDTDKTLMSKINSSPSGRISISIRLTPVKCNEEQQILPLSSHSPDKPTLTAYGSDSATSVFLGVPALGDDDSESLNNTGRTPRKREATPRRASVRGLKARTPSRRKDSASLKEPALTALAEEEHEDSPAQTAATPRSKRKSAQLVSSRIRKQLNLIANKFDLQSDGEDGDEDDCFVPSKIDLQSSSDEELEAKVDSEDELVVKKRRGSRTPRATDKSCVSARTPCKTPSKKAAPSTPRTPRHATPSIPSRTAPARKPGNVLEEARARLHVSAVPESLPCREQELQDIYNFVESKVIDGTGGCMYISGVPGTGKTATVHEVIRSLQQSAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTDQKATSDHAAALLEKRFSAPAPKKETTVLLVDELDLLWTRKQNVMYNLFDWPTRRNARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNRVKAFEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSGNQQKGSGLVGMSHVMEALDEMFSSSYIAAIRSASVQGQLLLRAVIAEFRRLGLEEATFQQVFVQHQALCRVEGLQPVSVSEGLLVCQRLGSCRLLLLEGSRLDLFLRIRLNVSQDDVLYALKAD 5A813B2B2A6E196D orc1-orc2-19 3237633 N/A 3237645 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3237646 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3237647 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3237648 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false h4(1129)-orc1-1 3237634 N/A 3237649 unspecified role unspecified role unspecified role unspecified role K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false Region 4-15 Region 4-15 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3237648 unspecified role unspecified role unspecified role unspecified role BAH domain Region 1-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q13415:p.Tyr64Ala Y64A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Trp88Ala W88A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Glu94Ala E94A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Tyr115Ala Y115A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Val90Ala V90A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Phe89Ser F89S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13415:p.Glu127Gly E127G mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13415:p.Cys120Ala C120A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h4(1129)-orc1-2 3237635 N/A 3237650 unspecified role unspecified role prey prey BAH domain Region 45-187 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3237649 unspecified role unspecified role bait bait K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false h4(1129)-orc1-3 3237636 N/A 3237651 unspecified role unspecified role prey prey BAH domain Region 9-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Z1N2:p.Tyr63Ala Y63A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Z1N2:p.Trp87Ala W87A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Z1N2:p.Glu93Ala E93A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Z1N2:p.Trp119Ala W119A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237649 unspecified role unspecified role bait bait K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false K10me1 K10me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false K10me3 K10me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false h4(1129)-orc1-4 3237637 N/A 3237652 unspecified role unspecified role prey prey BAH domain Region 45-171 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3237649 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false K10me3 K10me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false h4(1129)-xlorc1-1 3237638 N/A 3237653 unspecified role unspecified role prey prey BAH domain Region 44-169 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3237649 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false K10me1 K10me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false orc1-h4_bovin-1 3237639 N/A 3237654 unspecified role unspecified role prey prey K21me2 K21me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false bovin Bos taurus (Bovine) Bovine N/A 3237648 unspecified role unspecified role bait bait BAH domain Region 1-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q13415:p.Tyr64Ala Y64A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Trp88Ala W88A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Glu94Ala E94A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false h4(1129)-orc1-5 3237640 N/A 3237649 unspecified role unspecified role bait bait K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3237648 unspecified role unspecified role prey prey BAH domain Region 1-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q13415:p.Tyr64Ala Y64A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Trp88Ala W88A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Glu94Ala E94A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Cys120Ala C120A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q13415:p.Phe89Ser F89S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13415:p.Glu127Gly E127G mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h4(1129)-ddorc1-1 3237641 N/A 3237655 unspecified role unspecified role prey prey BAH domain Region 44-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3237649 unspecified role unspecified role bait bait K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false h4(1129)-orc1-6 3237642 N/A 3237651 unspecified role unspecified role unspecified role unspecified role BAH domain Region 9-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237649 unspecified role unspecified role unspecified role unspecified role K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false Region 4-15 Region 4-15 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false h4(1129)-orc1-7 3237643 N/A 3237649 unspecified role unspecified role bait bait K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3237648 unspecified role unspecified role prey prey BAH domain Region 1-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false h4(1129)-orc1-8 3237644 N/A 3237651 unspecified role unspecified role unspecified role unspecified role BAH domain Region 9-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3237649 unspecified role unspecified role unspecified role unspecified role K10me2 K10me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false Region 4-15 Region 4-15 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false K10me1 K10me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false K10me3 K10me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false