DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ li-2012-20 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255489X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-21 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255496X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-22 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255491X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-23 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255494X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-24 canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255499X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-25 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255497X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-26 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255495X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-27 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255490X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-28 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255493X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-29 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255492X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation li-2012-30 canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. DIP original experiment: DIP-255498X Nature structural & molecular biology 2012 IMEx Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. Li H., Pink MD., Murphy JG., Stein A., Dell'Acqua ML., Hogan PG. Only protein-protein interactions imex curation canb1_human Calcineurin subunit B type 1 PPP3R1 CNA2 CNB Protein phosphatase 2B regulatory subunit 1 Protein phosphatase 3 regulatory subunit B alpha isoform 1 protein protein human Homo sapiens Human MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV q08209-1 Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform PPP3CA CALNA CNA CAM-PRP catalytic subunit Calmodulin-dependent calcineurin A subunit alpha isoform protein protein human Homo sapiens Human MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ kap2_human cAMP-dependent protein kinase type II-alpha regulatory subunit PKR2 PRKAR2 PRKAR2A protein protein human Homo sapiens Human MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ akap5_human A-kinase anchor protein 5 A-kinase anchor protein 79 kDa cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein H21 AKAP5 AKAP79 protein protein human Homo sapiens Human METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVCESNVSNSTTSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIVAEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ ppp3ca-ppp3r1-9 3236967 N/A 3236978 unspecified role unspecified role prey prey Region 16-170 Region 16-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236979 unspecified role unspecified role bait bait Region 1-381 Region 1-381 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false akap5-ppp3ca-1 3236968 N/A 3236980 unspecified role unspecified role unspecified role unspecified role Region 1-45 Region 1-45 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236981 unspecified role unspecified role unspecified role unspecified role Region 333-408 Region 333-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236978 unspecified role unspecified role unspecified role unspecified role Region 16-170 Region 16-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236979 unspecified role unspecified role unspecified role unspecified role Region 1-381 Region 1-381 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false akap5-ppp3ca-2 3236969 N/A 3236981 unspecified role unspecified role unspecified role unspecified role Region 333-408 Region 333-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236978 unspecified role unspecified role unspecified role unspecified role Region 16-170 Region 16-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236979 unspecified role unspecified role unspecified role unspecified role Region 1-381 Region 1-381 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false akap5-ppp3ca-3 3236970 N/A 3236981 unspecified role unspecified role unspecified role unspecified role Region 333-408 Region 333-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236978 unspecified role unspecified role unspecified role unspecified role Region 16-170 Region 16-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236979 unspecified role unspecified role unspecified role unspecified role Region 1-381 Region 1-381 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false akap5-prkar2a-2 3236971 N/A 3236980 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris N/A 3236981 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris proximity proximity close-contact colocalization neighbourhood interaction false false false akap5-prkar2a-3 3236972 N/A 3236980 unspecified role unspecified role unspecified role unspecified role Region 1-45 Region 1-45 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236981 unspecified role unspecified role unspecified role unspecified role Region 333-408 Region 333-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false akap5-ppp3ca-4 3236973 N/A 3236981 unspecified role unspecified role fluorescence donor fluorescence donor Region 333-408 Region 333-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ATTO425-label ATTO425-label atto label atto label atto label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236979 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Region 1-381 Region 1-381 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Rhodamine-label Rhodamine-label tetramethyl rhodamine label tetramethyl rhodamine label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ppp3ca-ppp3r1-10 3236974 N/A 3236978 unspecified role unspecified role unspecified role unspecified role Region 16-170 Region 16-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236979 unspecified role unspecified role unspecified role unspecified role Region 1-381 Region 1-381 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ppp3ca-ppp3r1-11 3236975 N/A 3236978 unspecified role unspecified role unspecified role unspecified role Region 16-170 Region 16-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236979 unspecified role unspecified role unspecified role unspecified role Region 1-381 Region 1-381 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false akap5-ppp3ca-5 3236976 N/A 3236981 unspecified role unspecified role unspecified role unspecified role Region 333-408 Region 333-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236978 unspecified role unspecified role unspecified role unspecified role Region 16-170 Region 16-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236979 unspecified role unspecified role unspecified role unspecified role Region 1-381 Region 1-381 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false akap5-ppp3ca-6 3236977 N/A 3236981 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris N/A 3236979 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris proximity proximity close-contact colocalization neighbourhood interaction false false false