DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ green-2012-1 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as western blot western blot Immuno blot Immuno blot Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268041X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation green-2012-2 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268037X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation green-2012-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268043X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation green-2012-4 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268045X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation green-2012-5 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268038X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation green-2012-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268042X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation green-2012-7 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268040X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation green-2012-8 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268044X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation green-2012-9 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Green EM., Mas G., Young NL., Garcia BA., Gozani O. DIP original experiment: DIP-268039X Nature structural & molecular biology 2012 IMEx Methylation of H4 lysines 5, 8 and 12 by yeast Set5 calibrates chromatin stress responses. Green EM., Mas G., Young NL., Garcia BA., Gozani O. Only protein-protein interactions imex curation h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG set5_yeast Putative protein lysine methyltransferase SET5 SET domain-containing protein 5 SET5 YHR207C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTLTIKIGTLNDSDQSAVHNGTENGSDFRKITPTEEEICDDVVLLWKEEPGTEDATIQHLYDRITERNQSWKLSASRFRKILNEHHLYDTDLETVSLYKDKIHFPKALDSDAKVEVKFIDDEHGRGLFAKRDFSKGQIILKENKPIVYIPPLDKLFLISNGKACARCGKALYDLTQHKIMVHYLDCEVCKAIWCSEKCKKAHASLHELLYHSWRSNRIDILHAGNWKRFVNYCEKYCFTAAFSVGLIYGSMLLDTTGEVKEQWQKLASISQRERIKLRDASGIGSTFSLLNGTTVHTEEESDNGTKKGVEKNIDDETVWEKCYELFCGAFPKASEEIDFEKFLTMIGTFNINQYNGQVYHWISFINHDCEPNAYIEQVEEHEELRLHARKPIKKGEQIRITYVNPLHGVRLRRRELRVNWGFLCQCDRCQNELSTFERVPNLEKKNADANLGVEKIDSNDSSEDGSKKSTGNRKSSMREAQPDLKEILKNGKEFELDIPETVDTQGNVRKTSVRFDSNVSVAVDER 1113CB9C5223DC7D h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 h2a-2 Histone H2A tail protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast MSGGKGGKAGSAAKASQSRSAKAGLTFP set2_yeast Histone-lysine N-methyltransferase, H3 lysine-36 specific SET2 EZL1 YJL168C J0520 KMT3 SET domain-containing protein 2 Lysine N-methyltransferase 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKNQSVSASEDEKEILNNNAEGHKPQRLFDQEPDLTEEALTKFENLDDCIYANKRIGTFKNNDFMECDCYEEFSDGVNHACDEDSDCINRLTLIECVNDLCSSCGNDCQNQRFQKKQYAPIAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVIEEMEFRDRLIDYDQRHFKHFYFMMLQNGEFIDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQRKILKGEEITFDYNVDRYGAQAQKCYCEEPNCIGFLGGKTQTDAASLLPQNIADALGVTVSMEKKWLKLKKLSGEPIIKNENENINIEFLQSLEVQPIDSPVDVTKIMSVLLQQDNKIIASKLLKRLFTIDDDSLRHQAIKLHGYTCFSKMLKLFITEQPQVDGKGNETEEDDIKFIKGILDFLLELPKTTRNGIESSQIDNVVKTLPAKFPFLKPNCDELLEKWSKFETYKRITKKDINVAASKMIDLRRVRLPPGWEIIHENGRPLYYNAEQKTKLHYPPSGSSKVFSSRSNTQVNSPSSSGIPKTPGALDSKKHKLSDEEYERKKQKRLEYERIALERAKQEELESLKQKLKLENERKSVLEDIIAEANKQKELQKEEAKKLVEAKEAKRLKRKTVSQSQRLEHNWNKFFASFVPNLIKKNPQSKQFDHENIKQCAKDIVKILTTKELKKDSSRAPPDDLTKGKRHKVKEFINSYMDKIILKKKQKKALALSSASTRMSSPPPSTSS 05436B181E88EFF5 hist1h4a-set5-1 3236824 N/A 3236833 enzyme target enzyme target substrate substrate unspecified role unspecified role K6me1 K6me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236834 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli methylation methylation reaction methylation false false false h3-set5-1 3236825 N/A 3236835 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 2-46 Region 2-46 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236834 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli methylation methylation reaction methylation false false false h3-h4-1 3236826 N/A 3236836 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3236835 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false h2a-set5-1 3236827 N/A 3236837 enzyme target enzyme target substrate substrate unspecified role unspecified role h2a-2:p.[Lys5Arg;Lys8Arg] K5R/K8R mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false h2a-2:p.[Lys5Arg;Lys8Arg;Lys14Arg] K5R/K8R/K14R mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236834 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli methylation methylation reaction methylation false false false h3-set2-1 3236828 N/A 3236838 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3236835 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 2-46 Region 2-46 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli methylation methylation reaction methylation false false false h3-h4-2 3236829 N/A 3236834 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3236836 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3236835 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false hist1h4a-set5-2 3236830 N/A 3236833 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3236834 enzyme enzyme unspecified role unspecified role P38890:p.Tyr402Ala Y402A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli methylation methylation reaction methylation false false false h4-set5-1 3236831 N/A 3236836 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 2-24 Region 2-24 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false K6me1 K6me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false K13me1 K13me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3236834 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli methylation methylation reaction methylation false false false h4-set5-2 3236832 N/A 3236836 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 2-32 Region 2-32 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P02309:p.[Lys6Arg;Lys9Arg;Lys13Arg;Lys17Arg;Lys21Arg;Lys32Arg] K6R/K9R/K13R/K17R/K21R/K32R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P02309:p.[Lys6Arg;Lys9Arg;Lys13Arg] K6R/K9R/K13R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P02309:p.[Lys6Arg;Lys9Arg;Lys13Arg;Lys21Arg;Lys32Arg] K6R/K9R/K13R/K21R/K32R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P02309:p.[Lys6Arg;Lys9Arg;Lys13Arg;Lys17Arg;Lys32Arg] K6R/K9R/K13R/K17R/R/K32R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P02309:p.[Lys6Arg;Lys9Arg;Lys13Arg;Lys17Arg;Lys21Arg] K6R/K9R/K13R/K17R/K21R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3236834 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli methylation methylation reaction methylation false false false