DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fu-2012-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fu M., Zhang W., Wu L., Yang G., Li H., Wang R. DIP original experiment: DIP-251525X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Hydrogen sulfide (H2S) metabolism in mitochondria and its regulatory role in energy production. Fu M., Zhang W., Wu L., Yang G., Li H., Wang R. Only protein-protein interactions imex curation tom20_mouse Mitochondrial import receptor subunit TOM20 homolog Tomm20 Mitochondrial 20 kDa outer membrane protein Outer mitochondrial membrane receptor Tom20 protein protein mouse Mus musculus Mouse MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore mint cgl_mouse Cystathionine gamma-lyase Cth Cysteine-protein sulfhydrase Gamma-cystathionase protein protein mouse Mus musculus Mouse MQKDASLSGFLPSFQHFATQAIHVGQEPEQWNSRAVVLPISLATTFKQDFPGQSSGFEYSRSGNPTRNCLEKAVAALDGAKHSLAFASGLAATITITHLLKAGDEIICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIGACAQIVHKRGDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVNSDDLNSRLRFLQNSLGAVPSPFDCYLCCRGLKTLQVRMEKHFKNGMAVARFLETNPRVEKVVYPGLPSHPQHELAKRQCSGCPGMVSFYIKGALQHAKAFLKNLKLFTLAESLGGYESLAELPAIMTHASVPEKDRATLGINDTLIRLSVGLEDEQDLLEDLDRALKAAHP mint cth-tomm20-1 3236285 N/A 3236286 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3236287 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false