DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ engel-2012-1 in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252138X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions imex curation engel-2012-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252133X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions imex curation engel-2012-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252134X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions imex curation engel-2012-4 in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252139X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions imex curation engel-2012-5 in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252136X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions imex curation engel-2012-6 in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252137X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions imex curation engel-2012-7 in vitro In vitro ampylation assay ampylation assay ampylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. DIP original experiment: DIP-252135X Nature 2012 IMEx Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins. Engel P., Goepfert A., Stanger FV., Harms A., Schmidt A., Schirmer T., Dehio C. Only protein-protein interactions imex curation p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL ficd_human Protein adenylyltransferase FICD FICD HIP13 HYPE AMPylator FICD FIC domain-containing protein Huntingtin yeast partner E Huntingtin-interacting protein 13 Huntingtin-interacting protein E UNQ3041/PRO9857 De-AMPylase FICD protein protein human Homo sapiens Human MMLIPMASVMAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP vbha_barsr Antitoxin VbhA B11C_100027 protein protein barsr Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1) MLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI vbht_barsr Protein adenylyltransferase VbhT Toxin VbhT B11C_100026 vbhT AMPylator VbhT protein protein barsr Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1) MRKYEGSNDPYTDPETGVMYNLLGIKDQARLERVESAFAYIRSFELGRTSISGKFDLDHMKKIHKKLFGDVYEWAGKTRLVDIVKDNSKFAHYTQIESYAPQITQQLAREQHLRGLDANEFSQRAGYYMGELNALHPFREGNGRTLREFIWQLAREAGYHIDWDRVERQEMTRASIESYYGNSDLMSALIRRNLTEFTVNRRVDVSQGINERVLSHIDIDKEWPQKGFNIAIQTTQQAPYLSSYTDTSNLEEKAQNALRNEQSYVDTFKELNDHLKTIYKDPQAAALKIEQTILAGKGDKLPDILAKAPNKVGELRGSDRLIDKLKSAGKERKAALYNVPLAISTIRRLQSFYKNSYEKHMDKLTREREQLKVEVPSLSQEAVAYMKNVEVGRNNYSKIPENINKEFVQLESALNRRFGKDVIYKRNFNLSKEIASKQTYDKKLVNELQTAIKFLQQRHIQKQNNLAITRTPSKGITR p63000-1 Ras-related C3 botulinum toxin substrate 1 RAC1 Cell migration-inducing gene 5 protein Ras-like protein TC25 TC25 p21-Rac1 MIG5 Rac1A protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL mint sofic_sheon Protein adenylyltransferase SoFic fic AMPylator SoFic SO_4266 protein protein sheon Shewanella oneidensis (strain MR-1) MEWQAEQAYNHLPPLPLDSKLAELAETLPILKACIPARAALAELKQAGELLPNQGLLINLLPLLEAQGSSEIENIVTTTDKLFQYAQEDSQADPMTKEALRYRTALYQGFTQLSNRPLCVTTALEICSTIKSVQMDVRKVPGTSLTNQATGEVIYTPPAGESVIRDLLSNWEAFLHNQDDVDPLIKMAMAHYQFEAIHPFIDGNGRTGRVLNILYLIDQQLLSAPILYLSRYIVAHKQDYYRLLLNVTTQQEWQPWIIFILNAVEQTAKWTTHKIAAARELIAHTTEYVRQQLPKIYSHELVQVIFEQPYCRIQNLVESGLAKRQTASVYLKQLCDIGVLEEVQSGKEKLFVHPKFVTLMTKDSNQFSRYAL nmfic_neimb Protein adenylyltransferase NmFic AMPylator NmFic NMB0255 protein protein strain mc58 Neisseria meningitidis serogroup B MPSENPIGKTMKSIDEQSLHNARRLFESGDIDRIEVGTTAGLQQIHRYLFGGLYDFAGQIREDNISKGGFRFANAMYLKEALVKIEQMPERTFEEIIAKYVEMNIAHPFLEGNGRSTRIWLDLVLKKNLKKVVNWQNVSKTLYLQAMERSPVNDLELRFLLKDNLTDDVDNREIIFKGIEQSYYYEGYEKG cdc42-ficd-1 3235668 N/A 3235675 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3235676 enzyme enzyme unspecified role unspecified role FIC domain Region 187-437 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9BVA6:p.Glu234Gly E234G mutation increasing rate mutation increasing interaction rate mutation increasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli ampylation ampylation reaction ampylation false false false vbha_barsr-vbht-1 3235669 N/A 3235677 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235678 unspecified role unspecified role unspecified role unspecified role FIC domain Region 1-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false vbha_barsr-vbht-2 3235670 N/A 3235677 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235678 unspecified role unspecified role unspecified role unspecified role FIC domain Region 1-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ficd-rac1-1 3235671 N/A 3235679 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3235676 enzyme enzyme unspecified role unspecified role FIC domain Region 187-437 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9BVA6:p.Glu234Gly E234G mutation increasing rate mutation increasing interaction rate mutation increasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli ampylation ampylation reaction ampylation false false false fic-1 3235672 N/A 3235680 putative self putative self unspecified role unspecified role Q8E9K5:p.Glu73Gly E73G mutation increasing rate mutation increasing interaction rate mutation increasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli ampylation ampylation reaction ampylation false false false ficd-5 3235673 N/A 3235676 putative self putative self unspecified role unspecified role FIC domain Region 187-437 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9BVA6:p.Glu234Gly E234G mutation increasing rate mutation increasing interaction rate mutation increasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli ampylation ampylation reaction ampylation false false false nmfic_neimb-1 3235674 N/A 3235681 putative self putative self unspecified role unspecified role Y183-AMP Y183-AMP oamptyr O4'-(phospho-5'-adenosine)-L-tyrosine MOD_RES O-AMP-tyrosine (2S)-2-amino-3-[4-(5'-adenosine phosphonoxy)phenyl]propanoic acid 5'-adenylic-O-tyrosine O4'-(phospho-5'-adenosine)-L-tyrosine O4'-L-tyrosine 5'-adenosine phosphodiester hydrogen 5'-adenylate tyrosine ester AMP binding site O-5'-Adenosylation ( of Tyrosine) OAMPTyr Phosphoadenosine modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false Y188-AMP Y188-AMP oamptyr O4'-(phospho-5'-adenosine)-L-tyrosine MOD_RES O-AMP-tyrosine (2S)-2-amino-3-[4-(5'-adenosine phosphonoxy)phenyl]propanoic acid 5'-adenylic-O-tyrosine O4'-(phospho-5'-adenosine)-L-tyrosine O4'-L-tyrosine 5'-adenosine phosphodiester hydrogen 5'-adenylate tyrosine ester AMP binding site O-5'-Adenosylation ( of Tyrosine) OAMPTyr Phosphoadenosine modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false Q7DDR9:p.[Ser182Ala;Glu186Ala] S182A/E186A mutation increasing rate mutation increasing interaction rate mutation increasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Region 11-191 Region 11-191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli ampylation ampylation reaction ampylation false false false Deletion of region 168-191 decreased the interaction rate/strength.