DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mergenthaler-2012-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. DIP original experiment: DIP-251482X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. Only protein-protein interactions imex curation mergenthaler-2012-2 human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. DIP original experiment: DIP-251483X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. Only protein-protein interactions imex curation mergenthaler-2012-3 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. DIP original experiment: DIP-251484X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Mitochondrial hexokinase II (HKII) and phosphoprotein enriched in astrocytes (PEA15) form a molecular switch governing cellular fate depending on the metabolic state. Mergenthaler P., Kahl A., Kamitz A., van Laak V., Stohlmann K., Thomsen S., Klawitter H., Przesdzing I., Neeb L., Freyer D., Priller J., Collins TJ., Megow D., Dirnagl U., Andrews DW., Meisel A. Only protein-protein interactions imex curation pea15_mouse Astrocytic phosphoprotein PEA-15 Pea15 Pea15a 15 kDa phosphoprotein enriched in astrocytes protein protein mouse Mus musculus Mouse MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA mint Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm. Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface hxk2_mouse Hexokinase-2 Hk2 Hexokinase type II protein protein mouse Mus musculus Mouse MIASHMIACLFTELNQNQVQKVDQYLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEDDKDGIQKAYQILVRLGLSPLQEDCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKAVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLESLKLSHEQLLEVKRRMKVEMEQGLSKETHEAAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIRRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEEGRMCVNMEWGAFGDNGCLDDLRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILRHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFLESEDGSGKGAALITAVACRIREAGQR mint pea15_rat Astrocytic phosphoprotein PEA-15 Pea15 15 kDa phosphoprotein enriched in astrocytes protein protein rat Rattus norvegicus (Rat) Rat MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA mint Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm. Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface vdac1_rat Voltage-dependent anion-selective channel protein 1 Vdac1 Outer mitochondrial membrane protein porin 1 protein protein rat Rattus norvegicus (Rat) Rat MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA hxk2_rat Hexokinase-2 Hexokinase type II Hk2 Hexokinase-B protein protein rat Rattus norvegicus (Rat) Rat MIASHMIACLFTELNQNQVQKVDQFLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEEDKDGIEKAYQILMRLGLNPLQEDCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKAVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLESLKLSHEQLLEVKRRMKVEMEQGLSKETHAVAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEEGRMCVNMEWGAFGDNGCLDDLRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILRHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFLESEDGSGKGAALITAVACRIREAGQR hk2-pea15-1 3235064 N/A 3235067 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235068 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false hk2-pea15-2 3235065 N/A 3235067 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Venus-tag Venus-tag venus venus fluorescent protein tag venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3235068 unspecified role unspecified role fluorescence donor fluorescence donor Cerulean-tag Cerulean-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction false false false hk2-pea15-3 3235066 N/A 3235069 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3235070 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3235071 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat association association false false false