DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sandilands-2011-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sandilands E., Serrels B., McEwan DG., Morton JP., Macagno JP., McLeod K., Stevens C., Brunton VG., Langdon WY., Vidal M., Sansom OJ., Dikic I., Wilkinson S., Frame MC. DIP original experiment: DIP-268046X Nature cell biology 2011 IMEx Autophagic targeting of Src promotes cancer cell survival following reduced FAK signalling. Sandilands E., Serrels B., McEwan DG., Morton JP., Macagno JP., McLeod K., Stevens C., Brunton VG., Langdon WY., Vidal M., Sansom OJ., Dikic I., Wilkinson S., Frame MC. Only protein-protein interactions imex curation sandilands-2011-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sandilands E., Serrels B., McEwan DG., Morton JP., Macagno JP., McLeod K., Stevens C., Brunton VG., Langdon WY., Vidal M., Sansom OJ., Dikic I., Wilkinson S., Frame MC. DIP original experiment: DIP-268047X Nature cell biology 2011 IMEx Autophagic targeting of Src promotes cancer cell survival following reduced FAK signalling. Sandilands E., Serrels B., McEwan DG., Morton JP., Macagno JP., McLeod K., Stevens C., Brunton VG., Langdon WY., Vidal M., Sansom OJ., Dikic I., Wilkinson S., Frame MC. Only protein-protein interactions imex curation sandilands-2011-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sandilands E., Serrels B., McEwan DG., Morton JP., Macagno JP., McLeod K., Stevens C., Brunton VG., Langdon WY., Vidal M., Sansom OJ., Dikic I., Wilkinson S., Frame MC. DIP original experiment: DIP-268048X Nature cell biology 2011 IMEx Autophagic targeting of Src promotes cancer cell survival following reduced FAK signalling. Sandilands E., Serrels B., McEwan DG., Morton JP., Macagno JP., McLeod K., Stevens C., Brunton VG., Langdon WY., Vidal M., Sansom OJ., Dikic I., Wilkinson S., Frame MC. Only protein-protein interactions imex curation mlp3b_mouse Microtubule-associated proteins 1A/1B light chain 3B Map1lc3b Map1alc3 Map1lc3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein mouse Mus musculus Mouse MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV mint Probably involved in formation of autophagosomal vacuoles (autophagosomes) src_mouse Neuronal proto-oncogene tyrosine-protein kinase Src Src pp60c-src Proto-oncogene c-Src protein protein mouse Mus musculus Mouse MGSNKSKPKDASQRRRSLEPSENVHGAGGAFPASQTPSKPASADGHRGPSAAFVPPAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL cbl_mouse E3 ubiquitin-protein ligase CBL Signal transduction protein CBL Proto-oncogene c-Cbl Casitas B-lineage lymphoma proto-oncogene Cbl RING-type E3 ubiquitin transferase CBL protein protein mouse Mus musculus Mouse MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPSSPFSMAPQASLPPVPPRLDLLQQRAPVPASTSVLGTASKAASGSLHKDKPLPIPPTLRDLPPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLSRPIPKVPVATPNPGDPWNGRELTNRHSLPFSLPSQMEPRADVPRLGSTFSLDTSMTMNSSPVAGPESEHPKIKPSSSANAIYSLAARPLPMPKLPPGEQGESEEDTEYMTPTSRPVGVQKPEPKRPLEATQSSRACDCDQQIDSCTYEAMYNIQSQALSVAENSASGEGNLATAHTSTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTNFNEGSQVPERPPKPFPRRINSERKASSYQQGGGATANPVATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVAT cbl_human E3 ubiquitin-protein ligase CBL Signal transduction protein CBL Proto-oncogene c-Cbl Casitas B-lineage lymphoma proto-oncogene RING finger protein 55 CBL CBL2 RNF55 RING-type E3 ubiquitin transferase CBL protein protein human Homo sapiens Human MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVERPPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVSAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECDHPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRACDCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVAT mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV map1lc3b-src-1 3233384 N/A 3233387 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3233388 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false cbl-src-3 3233385 N/A 3233389 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3233388 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false map1lc3b-cbl-1 3233386 N/A 3233390 unspecified role unspecified role prey prey P22681:p.[Trp802Ala;Leu803Ala;Ser804Ala;Leu805Ala] W802A/L803A/S804A/L805A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P22681:p.[Trp802Ala;Leu805Ala] W802A/L805A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3233391 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false