DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ whitney-2011-1 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Whitney DS., Peterson FC., Volkman BF. DIP original experiment: DIP-220142X Structure (London, England : 1993) 2011 IMEx A conformational switch in the CRIB-PDZ module of Par-6. Whitney DS., Peterson FC., Volkman BF. Only protein-protein interactions imex curation whitney-2011-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Whitney DS., Peterson FC., Volkman BF. DIP original experiment: DIP-220143X Structure (London, England : 1993) 2011 IMEx A conformational switch in the CRIB-PDZ module of Par-6. Whitney DS., Peterson FC., Volkman BF. Only protein-protein interactions imex curation ligand PDZ ligand peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VKESLV o97111_drome par-6 DPar-6 DPar6 Dm-Par-6 Dm-Par6 DmPAR-6 DmPar-6 DmPar6 Dmel\CG5884 Dmpar6 PAR-6 PAR6 Par Par-6 Par6 dPAR-6 dPar-6 dmPar-6 par par6 Dmel_CG5884 CG5884 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSKNKINTTSATAASDTNLIEVKSKFDAEFRRWSFKRNEAEQSFDKFASLIEQLHKLTNIQFLILYIDPRDNDLLPINNDDNFGRALKTARPLLRVIVQRKDDLNEYSGFGTMKPRNLIGSILMGHTPVKTKAPSISIPHDFRQVSAIIDVDIVPETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQRTLTSTHRGSFSRNSQLSSGSHHTNNTNTSDEIEHDDQDDIVDLTGVTLDESPTSTSAGNHNHQPPLSSSPSSHHQQAASNASTIMASDVKDGVLHL cdc42_drome Cdc42 homolog CG12530 Cdc42 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCKFL ligand-par_6-1 3232581 N/A 3232583 unspecified role unspecified role unspecified role unspecified role Rhodamine-label Rhodamine-label fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3232584 unspecified role unspecified role unspecified role unspecified role PDZ domain Region 156-255 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O97111:p.[Gln144Cys;Leu164Cys] Q144C/L164C mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O97111:p.Lys165Leu K165L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O97111:p.Leu164Glu L164E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O97111:p.Leu164Lys L164K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cdc42-par_6-1 3232582 N/A 3232585 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3232584 unspecified role unspecified role unspecified role unspecified role CRIB-PDZ domain Region 130-255 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false