DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mhlebach-2011-1 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220299X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions imex curation mhlebach-2011-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220297X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions imex curation mhlebach-2011-3 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220301X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions imex curation mhlebach-2011-4 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220300X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions imex curation mhlebach-2011-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. DIP original experiment: DIP-220298X Nature 2011 IMEx Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Mühlebach MD., Mateo M., Sinn PL., Prüfer S., Uhlig KM., Leonard VH., Navaratnarajah CK., Frenzke M., Wong XX., Sawatsky B., Ramachandran S., McCray PB., Cichutek K., von Messling V., Lopez M., Cattaneo R. Only protein-protein interactions imex curation hema_measc Hemagglutinin glycoprotein H protein protein measc measles virus (strai MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRLHRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISDKIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQFLAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSSIVTMTSQGMYGGTYLVGKPNLSSKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPVSNDFSNCMVALGELKFAALCHREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLYLSSHRGVIADNQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLTVELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSPNLFTVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVYYVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMVGMGVSCTVTREDGTNRR nect4_human Nectin-4 NECTIN4 Ig superfamily receptor LNIR LNIR Nectin cell adhesion molecule 4 PRR4 PVRL4 Poliovirus receptor-related protein 4 protein protein human Homo sapiens Human MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV slaf1_human Signaling lymphocytic activation molecule SLAMF1 SLAM family member 1 SLAM CDw150 IPO-3 protein protein human Homo sapiens Human MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES nectin4-h-1 3232010 N/A 3232015 unspecified role unspecified role prey prey Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3232016 unspecified role unspecified role bait bait Region 1-141 Region 1-141 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction false false false h-nectin4-2 3232011 N/A 3232015 unspecified role unspecified role bait bait Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3232016 unspecified role unspecified role prey prey Ectodomain Region 1-331 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction false false false nectin4-h-2 3232012 N/A 3232015 unspecified role unspecified role prey prey Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3232016 unspecified role unspecified role bait bait Region 1-141 Region 1-141 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false slamf1-h-2 3232013 N/A 3232017 unspecified role unspecified role bait bait Ectodomain Region 21-230 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3232015 unspecified role unspecified role prey prey Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false h-slamf1-2 3232014 N/A 3232017 unspecified role unspecified role prey prey Ectodomain Region 21-230 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3232015 unspecified role unspecified role bait bait Ectodomain Region 60-617 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false