DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ licausi-2011-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. DIP original experiment: DIP-254469X Nature 2011 IMEx Oxygen sensing in plants is mediated by an N-end rule pathway for protein destabilization. Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. Only protein-protein interactions imex curation licausi-2011-2 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. DIP original experiment: DIP-254467X Nature 2011 IMEx Oxygen sensing in plants is mediated by an N-end rule pathway for protein destabilization. Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. Only protein-protein interactions imex curation licausi-2011-3 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. DIP original experiment: DIP-254468X Nature 2011 IMEx Oxygen sensing in plants is mediated by an N-end rule pathway for protein destabilization. Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. Only protein-protein interactions imex curation licausi-2011-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. DIP original experiment: DIP-254470X Nature 2011 IMEx Oxygen sensing in plants is mediated by an N-end rule pathway for protein destabilization. Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. Only protein-protein interactions imex curation licausi-2011-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. DIP original experiment: DIP-254472X Nature 2011 IMEx Oxygen sensing in plants is mediated by an N-end rule pathway for protein destabilization. Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. Only protein-protein interactions imex curation licausi-2011-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. DIP original experiment: DIP-254471X Nature 2011 IMEx Oxygen sensing in plants is mediated by an N-end rule pathway for protein destabilization. Licausi F., Kosmacz M., Weits DA., Giuntoli B., Giorgi FM., Voesenek LA., Perata P., van Dongen JT. Only protein-protein interactions imex curation acbp1_arath Acyl-CoA-binding domain-containing protein 1 ACBP1 ACBP At5g53470 MYN8.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADWYQLAQSIIFGLIFAYLLAKLISILLAFKDENLSLTRNHTTQSEYENLRKVETLTGISGETDSLIAEQGSLRGDEDESDDDDWEGVESTELDEAFSAATAFVAAAASDRLSQKVSNELQLQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIDLVTQLYPAWVEGGSKRRNRSGEAAGPMGPVFSSLVYEEESDNELKIDAIHAFAREGEVENLLKCIENGIPVNARDSEGRTPLHWAIDRGHLNVAEALVDKNADVNAKDNEGQTSLHYAVVCEREALAEFLVKQKADTTIKDEDGNSPLDLCESEWSWMREKKDSN ra212_arath Ethylene-responsive transcription factor RAP2-12 RAP2-12 ERF074 Protein RELATED TO APETALA2 12 T18A20.14 At1g53910 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNLKGSKKSSKNRSNFFDFDAEFEADFQGFKDDSSIDCDDDFDVGDVFADVKPFVFTSTPKPAVSAAAEGSVFGKKVTGLDGDAEKSANRKRKNQYRGIRQRPWGKWAAEIRDPREGARIWLGTFKTAEEAARAYDAAARRIRGSKAKVNFPEENMKANSQKRSVKANLQKPVAKPNPNPSPALVQNSNISFENMCFMEEKHQVSNNNNNQFGMTNSVDAGCNGYQYFSSDQGSNSFDCSEFGWSDQAPITPDISSAVINNNNSALFFEEANPAKKLKSMDFETPYNNTEWDASLDFLNEDAVTTQDNGANPMDLWSIDEIHSMIGGVF acbp2_arath Acyl-CoA-binding domain-containing protein 2 ACBP2 T27E11.20 At4g27780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDWAQLAQSVILGLIFSYLLAKLISIVVTFKEDNLSLTRHPEESQLEIKPEGVDSRRLDSSCGGFGGEADSLVAEQGSSRSDSVAGDDSEEDDDWEGVESTELDEAFSAATLFVTTAAADRLSQKVPSDVQQQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIEIVTQLYPTWLDGGVKAGSRGGDDAASNSRGTMGPVFSSLVYDEESENELKIDAIHGFAREGEVENLLKSIESGIPVNARDSEGRTPLHWAIDRGHLNIAKVLVDKNADVNAKDNEGQTPLHYAVVCDREAIAEFLVKQNANTAAKDEDGNSPLDLCESDWPWIRDSAKQAD acbp1-rap2_12-1 3231727 N/A 3231733 unspecified role unspecified role bait bait Region 31-338 Region 31-338 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3231734 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false acbp1-rap2_12-2 3231728 N/A 3231733 unspecified role unspecified role unspecified role unspecified role C-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3231734 unspecified role unspecified role unspecified role unspecified role N-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false acbp2-rap2_12-1 3231729 N/A 3231735 unspecified role unspecified role unspecified role unspecified role C-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3231734 unspecified role unspecified role unspecified role unspecified role N-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false acbp2-rap2_12-2 3231730 N/A 3231735 unspecified role unspecified role bait bait Region 32-354 Region 32-354 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3231734 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false acbp2-rap2_12-3 3231731 N/A 3231735 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3231734 unspecified role unspecified role prey prey region Δ1-177 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 1-176 Region 1-176 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 124-358 Region 124-358 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false acbp1-rap2_12-3 3231732 N/A 3231733 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3231734 unspecified role unspecified role prey prey region Δ1-177 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 1-176 Region 1-176 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 124-358 Region 124-358 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false