DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bertolotto-2011-1 human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Bertolotto C., Lesueur F., Giuliano S., Strub T., de Lichy M., Bille K., Dessen P., d'Hayer B., Mohamdi H., Remenieras A., Maubec E., de la Fouchardière A., Molinié V., Vabres P., Dalle S., Poulalhon N., Martin-Denavit T., Thomas L., Andry-Benzaquen P., Dupin N., Boitier F., Rossi A., Perrot JL., Labeille B., Robert C., Escudier B., Caron O., Brugières L., Saule S., Gardie B., Gad S., Richard S., Couturier J., Teh BT., Ghiorzo P., Pastorino L., Puig S., Badenas C., Olsson H., Ingvar C., Rouleau E., Lidereau R., Bahadoran P., Vielh P., Corda E., Blanché H., Zelenika D., Galan P., null null., Aubin F., Bachollet B., Becuwe C., Berthet P., Bignon YJ., Bonadona V., Bonafe JL., Bonnet-Dupeyron MN., Cambazard F., Chevrant-Breton J., Coupier I., Dalac S., Demange L., d'Incan M., Dugast C., Faivre L., Vincent-Fétita L., Gauthier-Villars M., Gilbert B., Grange F., Grob JJ., Humbert P., Janin N., Joly P., Kerob D., Lasset C., Leroux D., Levang J., Limacher JM., Livideanu C., Longy M., Lortholary A., Stoppa-Lyonnet D., Mansard S., Mansuy L., Marrou K., Matéus C., Maugard C., Meyer N., Nogues C., Souteyrand P., Venat-Bouvet L., Zattara H., Chaudru V., Lenoir GM., Lathrop M., Davidson I., Avril MF., Demenais F., Ballotti R., Bressac-de Paillerets B. DIP original experiment: DIP-248986X Nature 2011 IMEx A SUMOylation-defective MITF germline mutation predisposes to melanoma and renal carcinoma. Bertolotto C., Lesueur F., Giuliano S., Strub T., de Lichy M., Bille K., Dessen P., d'Hayer B., Mohamdi H., Remenieras A., Maubec E., de la Fouchardière A., Molinié V., Vabres P., Dalle S., Poulalhon N., Martin-Denavit T., Thomas L., Andry-Benzaquen P., Dupin N., Boitier F., Rossi A., Perrot JL., Labeille B., Robert C., Escudier B., Caron O., Brugières L., Saule S., Gardie B., Gad S., Richard S., Couturier J., Teh BT., Ghiorzo P., Pastorino L., Puig S., Badenas C., Olsson H., Ingvar C., Rouleau E., Lidereau R., Bahadoran P., Vielh P., Corda E., Blanché H., Zelenika D., Galan P., null null., Aubin F., Bachollet B., Becuwe C., Berthet P., Bignon YJ., Bonadona V., Bonafe JL., Bonnet-Dupeyron MN., Cambazard F., Chevrant-Breton J., Coupier I., Dalac S., Demange L., d'Incan M., Dugast C., Faivre L., Vincent-Fétita L., Gauthier-Villars M., Gilbert B., Grange F., Grob JJ., Humbert P., Janin N., Joly P., Kerob D., Lasset C., Leroux D., Levang J., Limacher JM., Livideanu C., Longy M., Lortholary A., Stoppa-Lyonnet D., Mansard S., Mansuy L., Marrou K., Matéus C., Maugard C., Meyer N., Nogues C., Souteyrand P., Venat-Bouvet L., Zattara H., Chaudru V., Lenoir GM., Lathrop M., Davidson I., Avril MF., Demenais F., Ballotti R., Bressac-de Paillerets B. Only protein-protein interactions imex curation sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV o75030-9 Microphthalmia-associated transcription factor MITF BHLHE32 Class E basic helix-loop-helix protein 32 protein protein human Homo sapiens Human MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC sumo1-mitf-1 3231643 N/A 3231644 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3231645 unspecified role unspecified role prey prey O75030-9:p.Glu318Lys E318K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O75030-9:p.[Lys182Arg;Glu318Lys] E318K/K182R mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false