DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wiedenheft-2011-11 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wiedenheft B., Lander GC., Zhou K., Jore MM., Brouns SJ., van der Oost J., Doudna JA., Nogales E. DIP original experiment: DIP-218917X Nature 2011 IMEx Structures of the RNA-guided surveillance complex from a bacterial immune system. Wiedenheft B., Lander GC., Zhou K., Jore MM., Brouns SJ., van der Oost J., Doudna JA., Nogales E. Only protein-protein interactions imex curation wiedenheft-2011-12 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Wiedenheft B., Lander GC., Zhou K., Jore MM., Brouns SJ., van der Oost J., Doudna JA., Nogales E. DIP original experiment: DIP-218919X Nature 2011 IMEx Structures of the RNA-guided surveillance complex from a bacterial immune system. Wiedenheft B., Lander GC., Zhou K., Jore MM., Brouns SJ., van der Oost J., Doudna JA., Nogales E. Only protein-protein interactions imex curation wiedenheft-2011-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wiedenheft B., Lander GC., Zhou K., Jore MM., Brouns SJ., van der Oost J., Doudna JA., Nogales E. DIP original experiment: DIP-218918X Nature 2011 IMEx Structures of the RNA-guided surveillance complex from a bacterial immune system. Wiedenheft B., Lander GC., Zhou K., Jore MM., Brouns SJ., van der Oost J., Doudna JA., Nogales E. Only protein-protein interactions imex curation cas6_ecoli CRISPR system Cascade subunit CasE casE CasE endoRNase cas6e crRNA endonuclease ygcH JW2726 b2756 protein protein ecoli Escherichia coli (strain K12) MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL cas5_ecoli CRISPR system Cascade subunit CasD casD cas5 ygcI b2757 JW5844 protein protein ecoli Escherichia coli (strain K12) MRSYLILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSESVQFAVRCDELILDDRRVSVTGLRDYHTVLGAREDYRGLKSHETIQTWREYLCDASFTVALWLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQASDPQKALLNYEPVGGDIYSEESVTGHHLKFTARDEPMITLPRQFASREWYVIKGGMDVSQ casc_ecoli CRISPR system Cascade subunit CasC casC cas4 cse4 ygcJ JW2728 b2758 protein protein ecoli Escherichia coli (strain K12) MSNFINIHVLISHSPSCLNRDDMNMQKDAIFGGKRRVRISSQSLKRAMRKSGYYAQNIGESSLRTIHLAQLRDVLRQKLGERFDQKIIDKTLALLSGKSVDEAEKISADAVTPWVVGEIAWFCEQVAKAEADNLDDKKLLKVLKEDIAAIRVNLQQGVDIALSGRMATSGMMTELGKVDGAMSIAHAITTHQVDSDIDWFTAVDDLQEQGSAHLGTQEFSSGVFYRYANINLAQLQENLGGASREQALEIATHVVHMLATEVPGAKQRTYAAFNPADMVMVNFSDMPLSMANAFEKAVKAKDGFLQPSIQAFNQYWDRVANGYGLNGAAAQFSLSDVDPITAQVKQMPTLEQLKSWVRNNGEA cse2_ecoli CRISPR system Cascade subunit CasB casB cse2 ygcK JW2729 b2759 protein protein ecoli Escherichia coli (strain K12) MADEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLRMVFCLSAGKNVIRHQDKKSEQTTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRLLTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKNA cse1_ecoli CRISPR system Cascade subunit CasA casA cse1 ygcL JW2730 b2760 CRISPR type I-E/Ecoli-associated protein CasA/Cse1 CRISPR-associated protein CasA/Cse1 protein protein ecoli Escherichia coli (strain K12) MNLLIDNWIPVRPRNGGKVQIINLQSLYCSRDQWRLSLPRDDMELAALALLVCIGQIIAPAKDDVEFRHRIMNPLTEDEFQQLIAPWIDMFYLNHAEHPFMQTKGVKANDVTPMEKLLAGVSGATNCAFVNQPGQGEALCGGCTAIALFNQANQAPGFGGGFKSGLRGGTPVTTFVRGIDLRSTVLLNVLTLPRLQKQFPNESHTENQPTWIKPIKSNESIPASSIGFVRGLFWQPAHIELCDPIGIGKCSCCGQESNLRYTGFLKEKFTFTVNGLWPHPHSPCLVTVKKGEVEEKFLAFTTSAPSWTQISRVVVDKIIQNENGNRVAAVVNQFRNIAPQSPLELIMGGYRNNQASILERRHDVLMFNQGWQQYGNVINEIVTVGLGYKTALRKALYTFAEGFKNKDFKGAGVSVHETAERHFYRQSELLIPDVLANVNFSQADEVIADLRDKLHQLCEMLFNQSVAPYAHHPKLISTLALARATLYKHLRELKPQGGPSNG casb-casa-2 3230665 N/A 3230668 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3230669 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3230670 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3230671 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3230672 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false casa-casb-5 3230666 N/A 3230668 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230669 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230670 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230671 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false casa-casb-6 3230667 N/A 3230668 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230669 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230670 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230671 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false