DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bai-2011-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column fingerprinting peptide massfingerprinting fingerprinting Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. DIP original experiment: DIP-218881X Structure (London, England : 1993) 2011 IMEx Characterization of the structure and function of Escherichia coli DegQ as a representative of the DegQ-like proteases of bacterial HtrA family proteins. Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. Only protein-protein interactions imex curation bai-2011-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. DIP original experiment: DIP-218877X Structure (London, England : 1993) 2011 IMEx Characterization of the structure and function of Escherichia coli DegQ as a representative of the DegQ-like proteases of bacterial HtrA family proteins. Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. Only protein-protein interactions imex curation bai-2011-5 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. DIP original experiment: DIP-218878X Structure (London, England : 1993) 2011 IMEx Characterization of the structure and function of Escherichia coli DegQ as a representative of the DegQ-like proteases of bacterial HtrA family proteins. Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. Only protein-protein interactions imex curation bai-2011-6 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. DIP original experiment: DIP-218882X Structure (London, England : 1993) 2011 IMEx Characterization of the structure and function of Escherichia coli DegQ as a representative of the DegQ-like proteases of bacterial HtrA family proteins. Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. Only protein-protein interactions imex curation bai-2011-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. DIP original experiment: DIP-218879X Structure (London, England : 1993) 2011 IMEx Characterization of the structure and function of Escherichia coli DegQ as a representative of the DegQ-like proteases of bacterial HtrA family proteins. Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. Only protein-protein interactions imex curation bai-2011-8 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. DIP original experiment: DIP-218883X Structure (London, England : 1993) 2011 IMEx Characterization of the structure and function of Escherichia coli DegQ as a representative of the DegQ-like proteases of bacterial HtrA family proteins. Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. Only protein-protein interactions imex curation bai-2011-9 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. DIP original experiment: DIP-218880X Structure (London, England : 1993) 2011 IMEx Characterization of the structure and function of Escherichia coli DegQ as a representative of the DegQ-like proteases of bacterial HtrA family proteins. Bai XC., Pan XJ., Wang XJ., Ye YY., Chang LF., Leng D., Lei J., Sui SF. Only protein-protein interactions imex curation ompa_ecoli Outer membrane protein A ompA tolG tut con Outer membrane protein II* b0957 JW0940 Outer membrane porin A Outer membrane protein 3A Outer membrane protein B Outer membrane protein d protein protein ecoli Escherichia coli (strain K12) MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA degq_ecoli Periplasmic pH-dependent serine endoprotease DegQ degQ hhoA b3234 JW3203 Protease Do protein protein ecoli Escherichia coli (strain K12) MKKQTQLLSALALSVGLTLSASFQAVASIPGQVADQAPLPSLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTNNHVINQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIVSALGRSGLNLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIKRGLLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPGSGSAKAGVKAGDIITSLNGKPLNSFAELRSRIATTEPGTKVKLGLLRNGKPLEVEVTLDTSTSSSASAEMITPALEGATLSDGQLKDGGKGIKIDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAAKPAIIALQIVRGNESIYLLMR degp_ecoli Periplasmic serine endoprotease DegP degP htrA ptd b0161 JW0157 Heat shock protein DegP Protease Do protein protein ecoli Escherichia coli (strain K12) MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ degq-ompa-1 3230334 N/A 3230341 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230342 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degp-12 3230335 N/A 3230343 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degp-13 3230336 N/A 3230343 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degq-1 3230337 N/A 3230342 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degq-2 3230338 N/A 3230342 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degq-ompa-2 3230339 N/A 3230341 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3230342 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degq-3 3230340 N/A 3230342 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false