DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fang-2011-7 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Fang PA., Conway JF., Margolis HC., Simmer JP., Beniash E. DIP original experiment: DIP-249684X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Hierarchical self-assembly of amelogenin and the regulation of biomineralization at the nanoscale. Fang PA., Conway JF., Margolis HC., Simmer JP., Beniash E. Only protein-protein interactions imex curation p63277-1 Amelogenin, X isoform Amelx Amel Leucine-rich amelogenin peptide protein protein mouse Mus musculus Mouse MGTWILFACLLGAAFAMPLPPHPGSPGYINLSYEVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD amelx-1 3229119 N/A 3229120 unspecified role unspecified role unspecified role unspecified role Region 17-183 Region 17-183 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false