DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bracher-2011-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218657X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions imex curation bracher-2011-2 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218662X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions imex curation bracher-2011-3 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218660X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions imex curation bracher-2011-4 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218658X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions imex curation bracher-2011-5 ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218661X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions imex curation bracher-2011-6 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218663X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions imex curation bracher-2011-7 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. DIP original experiment: DIP-218659X Nature structural & molecular biology 2011 IMEx Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco. Bracher A., Starling-Windhof A., Hartl FU., Hayer-Hartl M. Only protein-protein interactions imex curation rbcx_anasc RuBisCO chaperone RbcX rbcX protein protein anasc Anabaena sp. (strain CA / ATCC 33047) MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSHPSPESEQQQFSDPDWDNLAS rbl_synp6 Ribulose bisphosphate carboxylase large chain cbbL rbcA rbcL syc0130_c protein protein anacystis nidulans Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) Anacystis nidulans MPKTQSAAGYKAGVKDYKLTYYTPDYTPKDTDLLAAFRFSPQPGVPADEAGAAIAAESSTGTWTTVWTDLLTDMDRYKGKCYHIEPVQGEENSYFAFIAYPLDLFEEGSVTNILTSIVGNVFGFKAIRSLRLEDIRFPVALVKTFQGPPHGIQVERDLLNKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKSQAETGEIKGHYLNVTAPTCEEMMKRAEFAKELGMPIIMHDFLTAGFTANTTLAKWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGDKASTLGFVDLMREDHIEADRSRGVFFTQDWASMPGVLPVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATANRVALEACVQARNEGRDLYREGGDILREAGKWSPELAAALDLWKEIKFEFETMDKL rbcx_synp6 RuBisCO chaperone RbcX rbcX syc2521_d protein protein anacystis nidulans Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) Anacystis nidulans MQFMGTASRMASTQRAKPMEMPRISRDTARMLVNYLTYQAVCVIRDQLAETNPAGAYRLQVFSAEFSFQDGEAYLAALLNHDRELGLRVMTVREHLAEHILDYLPEMTIAQIQEANINHRRALLERLTGLGAEPSLPETEVSDRPSDSATPDDASNASHAD cbbl-rbcx-1 3228564 N/A 3228571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3228572 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cbbl-syn6301rbcx-1 3228565 N/A 3228573 unspecified role unspecified role unspecified role unspecified role A0A0H3K9R3:p.Thr51Cys T51C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228572 unspecified role unspecified role unspecified role unspecified role P00880:p.Glu49Cys E49C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cbbl-1 3228566 N/A 3228572 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rbcx-cbbl-1 3228567 N/A 3228571 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3228572 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false syn6301rbcx-cbbl-1 3228568 N/A 3228573 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3228572 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false cbbl-rbcx-2 3228569 N/A 3228571 unspecified role unspecified role unspecified role unspecified role Q44212:p.Thr33Cys T33C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228572 unspecified role unspecified role unspecified role unspecified role P00880:p.Glu49Cys E49C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false syn6301rbcx-cbbl-2 3228570 N/A 3228573 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3228572 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false