DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lord-2011-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219004X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions imex curation lord-2011-2 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-218999X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions imex curation lord-2011-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219006X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions imex curation lord-2011-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219003X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions imex curation lord-2011-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219001X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions imex curation lord-2011-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219005X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions imex curation lord-2011-7 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219000X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions imex curation lord-2011-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219002X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions imex curation sec24_yeast Protein transport protein SEC24 SEC24 Abnormal nuclear morphology 1 ANU1 YIL109C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQFLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPAYGQPSAAMGQNMRPMNQLYPIDLLTELPPPITDLTLPPPPLVIPPERMLVPSELSNASPDYIRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDGLIVRCRRCRSYMNPFVTFIEQGRRWRCNFCRLANDVPMQMDQSDPNDPKSRYDRNEIKCAVMEYMAPKEYTLRQPPPATYCFLIDVSQSSIKSGLLATTINTLLQNLDSIPNHDERTRISILCVDNAIHYFKIPLDSENNEESADQINMMDIADLEEPFLPRPNSMVVSLKACRQNIETLLTKIPQIFQSNLITNFALGPALKSAYHLIGGVGGKIIVVSGTLPNLGIGKLQRRNESGVVNTSKETAQLLSCQDSFYKNFTIDCSKVQITVDLFLASEDYMDVASLSNLSRFTAGQTHFYPGFSGKNPNDIVKFSTEFAKHISMDFCMETVMRARGSTGLRMSRFYGHFFNRSSDLCAFSTMPRDQSYLFEVNVDESIMADYCYVQVAVLLSLNNSQRRIRIITLAMPTTESLAEVYASADQLAIASFYNSKAVEKALNSSLDDARVLINKSVQDILATYKKEIVVSNTAGGAPLRLCANLRMFPLLMHSLTKHMAFRSGIVPSDHRASALNNLESLPLKYLIKNIYPDVYSLHDMADEAGLPVQTEDGEATGTIVLPQPINATSSLFERYGLYLIDNGNELFLWMGGDAVPALVFDVFGTQDIFDIPIGKQEIPVVENSEFNQRVRNIINQLRNHDDVITYQSLYIVRGASLSEPVNHASAREVATLRLWASSTLVEDKILNNESYREFLQIMKARISK 35E2BDD24CC75899 sec23_yeast Protein transport protein SEC23 SEC23 P9705.14 YPR181C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDFETNEDINGVRFTWNVFPSTRSDANSNVVPVGCLYTPLKEYDELNVAPYNPVVCSGPHCKSILNPYCVIDPRNSSWSCPICNSRNHLPPQYTNLSQENMPLELQSTTIEYITNKPVTVPPIFFFVVDLTSETENLDSLKESIITSLSLLPPNALIGLITYGNVVQLHDLSSETIDRCNVFRGDREYQLEALTEMLTGQKPTGPGGAASHLPNAMNKVTPFSLNRFFLPLEQVEFKLNQLLENLSPDQWSVPAGHRPLRATGSALNIASLLLQGCYKNIPARIILFASGPGTVAPGLIVNSELKDPLRSHHDIDSDHAQHYKKACKFYNQIAQRVAANGHTVDIFAGCYDQIGMSEMKQLTDSTGGVLLLTDAFSTAIFKQSYLRLFAKDEEGYLKMAFNGNMAVKTSKDLKVQGLIGHASAVKKTDANNISESEIGIGATSTWKMASLSPYHSYAIFFEIANTAANSNPMMSAPGSADRPHLAYTQFITTYQHSSGTNRIRVTTVANQLLPFGTPAIAASFDQEAAAVLMARIAVHKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMEDDPQPVLLDSISVKPNTILLLDTFFFILIYHGEQIAQWRKAGYQDDPQYADFKALLEEPKLEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDNYQDMARGGSTIVLTDDVSLQNFMTHLQQVAVSGQA 69811913848265FB hrr25_yeast Casein kinase I homolog HRR25 YPL204W HRR25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTMLRYTKAMVEKQRDLLIEKGDLNANSNAASASNSTDNKSETFNKIKLLAMKKFPTHFHYYKNEDKHNPSPEEIKQQTILNNNAASSLPEELLNALDKGMENLRQQQPQQQVQSSQPQPQPQQLQQQPNGQRPNYYPEPLLQQQQRDSQEQQQQVPMATTRATQYPPQINSNNFNTNQASVPPQMRSNPQQPPQDKPAGQSIWL C4D3107A470E8BAF trs33_yeast Trafficking protein particle complex subunit 33 TRS33 YOR115C O3251 YOR3251C Transport protein particle 33 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSTHSNNVGHPQSSPQGPLTEQQRAQQQYQIFENSLPKVSQSVYQMLLNEMVPLAMGIERQISGDVISSDSNVTSENGNINNMIKRLKIEEHHTVDIIRSHNLIHELYKADEEEKEKVLARLRNIGFQIGLKLSELLIFSNNPNLKFKEMDLLLIMKFICRDVWKQIFGKQIDNLKTNHRGTFYLLDYDYRPIQSFSLEEDAKNEELKMIEPFLEIPVGIIRGVLSSLGYSSEEVICLASFIDRPTDRPKTAFPKGVSFHVQVTMPQ 2480F69D7A48D363 sar1_yeast Small COPII coat GTPase SAR1 YPL218W SAR1 GTP-binding protein SAR1 Secretion-associated RAS-related protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAGWDIFGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI E2348B57896B5A13 sec23p-sec24p-1 3225599 N/A 3225607 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225608 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false hrr25p-sec23p-1 3225600 N/A 3225609 enzyme enzyme unspecified role unspecified role P29295:p.Lys38Ala K38A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225608 enzyme target enzyme target substrate substrate unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false pT555 pT555 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false pS742 pS742 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false pT747 pT747 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false sec23p-sar1p-1 3225601 N/A 3225610 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225611 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 24-190 Region 24-190 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3225608 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false sec23p-hrr25p-1 3225602 N/A 3225609 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225610 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225608 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false sec23p-hrr25p-2 3225603 N/A 3225609 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225608 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false sec23p-sar1p-2 3225604 N/A 3225611 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 24-190 Region 24-190 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3225608 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P15303:p.Ser742Asp S742D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P15303:p.Thr747Glu T747E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P15303:p.[Ser742Asp;Thr747Glu] S742D/T747E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hrr25p-sec24p-1 3225605 N/A 3225607 enzyme target enzyme target substrate substrate unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225609 enzyme enzyme unspecified role unspecified role P29295:p.Lys38Ala K38A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false sec23p-trs33p-1 3225606 N/A 3225610 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225608 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P15303:p.[Ser742Asp;Thr747Glu] S742D/T747E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false