DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ brams-2011-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Brams M., Pandya A., Kuzmin D., van Elk R., Krijnen L., Yakel JL., Tsetlin V., Smit AB., Ulens C. DIP original experiment: DIP-216769X PLoS biology 2011 IMEx A structural and mutagenic blueprint for molecular recognition of strychnine and d-tubocurarine by different cys-loop receptors. Brams M., Pandya A., Kuzmin D., van Elk R., Krijnen L., Yakel JL., Tsetlin V., Smit AB., Ulens C. Only protein-protein interactions imex curation q8wsf8_aplca protein protein aplca Aplysia californica (California sea hare) California sea hare MLVSVYLALLVACVGQAHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD mint q8wsf8_aplca-5 3224691 N/A 3224692 unspecified role unspecified role unspecified role unspecified role Mature protein Region 20-236 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false