DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ joyce-2011-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Joyce MG., Tran P., Zhuravleva MA., Jaw J., Colonna M., Sun PD. DIP original experiment: DIP-250966X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site. Joyce MG., Tran P., Zhuravleva MA., Jaw J., Colonna M., Sun PD. Only protein-protein interactions imex curation joyce-2011-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Joyce MG., Tran P., Zhuravleva MA., Jaw J., Colonna M., Sun PD. DIP original experiment: DIP-250967X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site. Joyce MG., Tran P., Zhuravleva MA., Jaw J., Colonna M., Sun PD. Only protein-protein interactions imex curation nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG nr3l1_human Natural cytotoxicity triggering receptor 3 ligand 1 NCR3LG1 B7 homolog 6 B7H6 protein protein human Homo sapiens Human MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIVLIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQLDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDAPILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ ncr3-9 3223893 N/A 3223895 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 18-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ncr3lg1-ncr3-4 3223894 N/A 3223896 unspecified role unspecified role bait bait Region 31-144 Region 31-144 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3223895 unspecified role unspecified role prey prey Extracellular domain Region 18-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O14931:p.[Ile50Ala;Ser52Ala] I50A/S52A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O14931:p.[Glu65Ser;Arg67Ser] E65S/R67S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O14931:p.[Arg109Ser;Glu111Ser;Leu113Ala] R109S/E111S/L113A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O14931:p.[Arg109Glu;Glu111Arg;Leu113Ala] R109E/E111R/L113A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false