DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cheng-2011-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cheng WW., McCoy JG., Thompson AN., Nichols CG., Nimigean CM. DIP original experiment: DIP-250965X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Mechanism for selectivity-inactivation coupling in KcsA potassium channels. Cheng WW., McCoy JG., Thompson AN., Nichols CG., Nimigean CM. Only protein-protein interactions imex curation kcsa_strli pH-gated potassium channel KcsA Streptomyces lividans K+ channel kcsA skc1 protein protein strli Streptomyces lividans MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR mint kcsa-25 3223422 N/A 3223423 unspecified role unspecified role unspecified role unspecified role Region 2-124 Region 2-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P0A334:p.Glu71Ala E71A mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false