DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ costa-2011-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper density sedimentation cosedimentation through density gradient density sedimentation weight silver stain molecular weight estimation by silver staining weight silver stain Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218501X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-3 trini Trichoplusia ni (Cabbage looper) Cabbage looper ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218506X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-4 trini Trichoplusia ni (Cabbage looper) Cabbage looper anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218509X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-5 trini Trichoplusia ni (Cabbage looper) Cabbage looper anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218507X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-6 trini Trichoplusia ni (Cabbage looper) Cabbage looper tem transmission electron microscopy tem predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218503X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-7 trini Trichoplusia ni (Cabbage looper) Cabbage looper anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218508X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-8 trini Trichoplusia ni (Cabbage looper) Cabbage looper density sedimentation cosedimentation through density gradient density sedimentation weight silver stain molecular weight estimation by silver staining weight silver stain Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218502X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-9 trini Trichoplusia ni (Cabbage looper) Cabbage looper ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218505X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-10 trini Trichoplusia ni (Cabbage looper) Cabbage looper tem transmission electron microscopy tem predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218504X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-11 trini Trichoplusia ni (Cabbage looper) Cabbage looper anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218511X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-12 trini Trichoplusia ni (Cabbage looper) Cabbage looper anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218512X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation costa-2011-13 trini Trichoplusia ni (Cabbage looper) Cabbage looper anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. DIP original experiment: DIP-218510X Nature structural & molecular biology 2011 IMEx The structural basis for MCM2-7 helicase activation by GINS and Cdc45. Costa A., Ilves I., Tamberg N., Petojevic T., Nogales E., Botchan MR., Berger JM. Only protein-protein interactions imex curation q9vbi1_drome DNA replication complex GINS protein SLD5 Sld5 Dmel\CG14549 anon-WO0172774.61 Dmel_CG14549 CG14549 SLD5 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDVEDVPETQLEIDVSDGAGLEDEDDDDMEQITAQKVLEIIETAWINEMCAPEILPSQTDMLELMVSQVAHMEEQMRDLDKNDFRAVVHSMELERVRYIMASYLRCRLQKIETFTQHILNQEESREPDDKRLSPEETKFAQEFASNVDEYFHKVATQYMPNQQRGEAEQRIVTPNLMSHVFLKANVAVPAVIVGVDDEEVDMAAGSQHIIPYQLVADLIQNNQAQLI q9w2v7_drome DNA replication complex GINS protein PSF3 Dmel\CG2222 Psf3 PSF3 CG2222 Dmel_CG2222 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNGMNYFPNYYSIEDIFVTQEKVECRVNTKLQRMGFLDSGAESDDLEPGRTVNLPLWYIKELKVNNAYFTVAVPDIYRNVHKAVCEAETTHIELGRLHPYFYEFGRYLTPYDRNHVIGRIIFETLRQRVRHLLDISKSDGQAAKAEHRLDNIEAKLHEAGVRTNSQYIEWLQMTGNKIRTSELVEEHQKKRRRADRSDDEGDALPNSKRATL psf2_drome Probable DNA replication complex GINS protein PSF2 CG18013 GINS complex subunit 2 Psf2 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDPSIIEFIGEKCMISIIPNFSNEPLHLIYGPVGPFRAGFPVFVPLWMATHLRKQQKCRIVPPEWMDMDILEEIKEEEKRSKFFTKMPCEHYMVVAQLVMSTAPDDVPRCEELRTVIKDIFDIRESKLRTSIDAFIKGEGTYAKLDNLTLLEIHSVRPILPYSLDHIARYQRTATASQRDTSMLSASMAGSSSGPNSNSLFSQ q9w0i7_drome GINS complex subunit 1 Psf1 CG9187-PA Dmel\CG9187 psf1 Dmel_CG9187 CG9187 PSF1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRQTKMFGEKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLLNFRHAALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGYNQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILHHIA o96989_drome Cdc45 CDC45 CDC45L D DmCdc45 Dmel\CG3658 EG:BACR7A4.11 anon-1Ec cdc45 dCDC45 dCDC45L CG3658 Dmel_CG3658 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFVQDLRNDFYRQLVGKRILIVVNYDIDAICASRILQALFKYDHMLYTVVPIMGVTGLKRAYGEHQGDVKYVVLVNCGGCVDIVELLQPSDDVTFFICDSHRPLDVCNIYSDRQVCILGDASLEENIPAFETIFYDSEGEDEDEDESSDTEQQHDDSGAGESDQEDQAPRSRKLSRLERHEQRILKQRARRQWESERDRIMFEYTQFSYYGRSAALMVFELAWKLSKDNMDLLWWAIVGITEQLLLGKIESGAYTLELEQIQSHVSRLTNKTNDQNTMSASKITFENDLHLVLYRHWPVTESMRYSRYSSCQLKLWTLRGEKRLHELLLEMGLPLVHARQTYGAMDLVLRKEFFSMVERLAEKYDIADIVYGTFTLSYGYRSRYAAADYVYALLAIMESVKKHKTPEDCFLEASDALSRQHKQLLSAGIDQAKLLHAAVFRQVQSSLEARQVHSAGSFFYYVLQEEHAFFSYPYALGLLARFLLRGHVATSRARQASDLPLIASCPLNASEGMCLLVGIVPVREDSPRNFFGKAFEQAAQKSGVALLQDFFEPAVVQLRQSDLTRFLDSLTVLLA mcm7_drome DNA replication licensing factor Mcm7 CG4978 Mcm7 Minichromosome maintenance 7 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MARRDYAQDRESIKTFLSEFCKCDDDGKKEFVYGSQLVKLAHREQVLITIDLDDLAEFNESLAEAVVDNCRRYTSIFSDVIAELLPSYKQQEVHAKDALDVYIEHRLMMESRTRNPMEQRDERNSFPSELMKRFEVGFKPLSTEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDRCGSETYQPVNSLSFTPVHDCPSDDCRVNKAGGRLYLQTRGSKFVKFQEVKMQEHSDQVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFLPLMRTGFAQMIQGLLSETFLQAHRIICINKNDEISDKDAELTPEELEELAQDDFYERLATSLAPEIYGHLDVKKALLLLLVGGVDKRPDGMKIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYVHSHSKQPPTRVKALDMNLMRRYINLCKRKNPTIPDELTDYIVGAYVELRREARNQKDMTFTSARNLLGILRLSTALARLRLSDSVEKDDVAEALRLLEMSKDSLNQIHEHQKGHVPNTSDRIFAIVRELAGSGKAVKISDIMDRCTTKGFKPDQVDKCIDDYEELNVWQVNMGRTKITFM mcm6_drome DNA replication licensing factor Mcm6 Mcm6 CG4039 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDVADAQVGQLRVKDEVGIRAQKLFQDFLEEFKEDGEIKYTRPAASLESPDRCTLEVSFEDVEKYDQNLATAIIEEYYHIYPFLCQSVSNYVKDRIGLKTQKDCYVAFTEVPTRHKVRDLTTSKIGTLIRISGQVVRTHPVHPELVSGVFMCLDCQTEIRNVEQQFKFTNPTICRNPVCSNRKRFMLDVEKSLFLDFQKIRIQETQAELPRGCIPRAVEIILRSELVETVQAGDRYDFTGTLIVVPDVSVLAGVGTRAENSSRHKPGEGMDGVTGLKALGMRELNYRMAFLACSVQATTARFGGTDLPMSEVTAEDMKKQMTDAEWHKIYEMSKDRNLYQNLISSLFPSIYGNDEVKRGILLQQFGGVAKTTTEKTSLRGDINVCIVGDPSTAKSQFLKQVSDFSPRAIYTSGKASSAAGLTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAGVRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAIARKIVDLHSNIEESVERAYTREEVLRYVTFARQFKPVISQEAGHMLVENYGHLRQRDTGTSGRSTWRITVRQLESMIRLSEAMAKLECSNRVLERHVKEAFRLLNKSIIRVEQPDIHLDDDEGLDMDDGIQHDIDMENNGAAANVDENNGMDTSASGAVQKKKFTLSFEDYKNLSTMLVLHMRAEEARCEVEGNDTGIKRSNVVTWYLEQVADQIESEDELISRKNLIEKLIDRLIYHDQVIIPLKTSTLKPRIQVQKDFVEEDDPLLVVHPNYVVE mcm5_drome DNA replication licensing factor Mcm5 Mcm5 CG4082 Minichromosome maintenance 5 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEGFDDAGVFFSDNFGGDNQQDAQINLQAVKKKYKEFIRTFNEENFFYKYRDTLKRNYLNGRYFLEIEMEDLVGFDETLADKLNKQPTEHLEIFEEAAREVADEITAPRPEHEEHMHDIQILLSSNANPTNIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNLKVNPGLEGYALPRKCNTEQAGRPKCPLDPFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAVVGVRAPYMRVVGITVDSEGAGAISRYSNITSDEEEHFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKGEENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSSNKSAPSEPAEGEISLSTFKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSGAGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTLDAAMTGSLAGAEGFTTEEDQETLNRIEKQLKRRFAIGSQVSEQNILQDFLRQKYEERTVMKVIHTMIRRGELQHRMQRKMLYRIC mcm4_drome DNA replication licensing factor MCM4 dpa CG1616 Protein disc proliferation abnormal protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSPARSPSVGGATPKQGARTPTRGIASQDVETPMRMGPGRAVRPSDNISLPPTSPGNISLPATSPARGLGANMSEIDLSSPLNYGTPSSMGSIRTPRSGIRGTPLRARPDIRTDKRIRQVAIGGGSGLEPIPEKGSETTDPVSESSQAPQLVVWGTNVVVSQCKSKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYPAALLEHQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRINQPTLCTNCNTNHCFRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDTMFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSTAARKKRADLVAAIKENLKKKGKVLTVPYQKLFSDIKEGSQIMITREQFEDALKEVQDEGAIVVMGKNTIRIC mcm3_drome DNA replication licensing factor Mcm3 Mcm3 CG4206 Mcm3-RA Minichromosome maintenance 3 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAHEGEQFIKDIQREYVDFLDDEEDQGIYAGHVKDMIAEKSKRLIVNVNDLKRKNPQRALGLLSNAADEQLAFGRALKEYASTVDPGYAKMHEDLFVGFEGCFGNRHVTPRSLTSIYLGNMVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEAVPSGAAYPTKDEDGNLLETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRCLPGKRGGYTSGTFRTVLLANNISLLSKESNLDISREDIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEKYDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVETDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVLDKDRPSKRRRNSGSDAEDDNGEASSQRSPSRRSKRTRTATVGADSDEEDIEPPQPDAGDLTRRETRRSLPARSVAMLMASPSSEEQSVATSTTEPAIISDARLGEFKNNLQRLFREAREQSLALARITTAINVGSQEPFTAGEIEAAVHRMTEDNQIMVADDIVFLI mcm2_drome DNA replication licensing factor Mcm2 Mcm2 CG7538 Minichromosome maintenance 2 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDNPSSPPPNTPSDAAERRDLRAAMTSPVGDFEPFENEDEILGDQTVRDEAEEEDGEELFGDNMENDYRPMPELDHYDPALLDDEDDFSEMSQGDRFAAESEMRRRDRAAGIHRDDRDLGFGQSDDEDDVGPRAKRRAGEKAAVGEVEDTEMVESIENLEDTKGHSTKEWVSMLGPRTEIANRFQSFLRTFVDERGAYTYRDRIRRMCEQNMSSFVVSYTDLANKEHVLAYFLPEAPFQMLEIFDKVAKDMVLSIFPTYERVTTEIHVRISELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKCGYVLGPFVQSQNTEIKPGSCPECQSTGPFSINMEQTLYRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGFPVFATVIIANHVVVKDSKQVVQSLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEEEQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLRQESFATGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFIEAQKFSVMKKMRSTFQKYLSFQKDHSELLFFILRQLTLDQLAYIRCKDGPGATHVEIMERDLIERAKQLDIVNLKPFYESDLFRTNGFSYDPKRRIILQIVVDGNTA cdc45l-dpa-4 3223047 N/A 3223059 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223060 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223061 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223062 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223063 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223064 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223065 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223067 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false dpa-mcm2-2 3223048 N/A 3223064 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223065 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223067 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false mcm3-mcm2-10 3223049 N/A 3223066 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false mcm3-cdc45l-1 3223050 N/A 3223059 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223060 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223061 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223062 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223063 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223064 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223065 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223067 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false cdc45l-dpa-5 3223051 N/A 3223059 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223060 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223061 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223062 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223063 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223064 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223065 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223067 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false mcm3-dpa-1 3223052 N/A 3223064 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223065 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223067 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false dpa-mcm2-3 3223053 N/A 3223064 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223065 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223067 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false cdc45l-dpa-6 3223054 N/A 3223059 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223060 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223061 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223062 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223063 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223064 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223065 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223067 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false dpa-mcm2-4 3223055 N/A 3223064 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223065 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223067 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false sld5-psf1-1 3223056 N/A 3223059 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223061 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223062 unspecified role unspecified role prey prey Region 1-139 Region 1-139 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false sld5-psf1-2 3223057 N/A 3223060 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223059 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223062 unspecified role unspecified role prey prey Region 1-139 Region 1-139 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false mcm3-cdc45l-2 3223058 N/A 3223059 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223061 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223062 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223063 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223066 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223068 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3223069 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false