DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ shi-2011-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shi R., McDonald L., Cui Q., Matte A., Cygler M., Ekiel I. DIP original experiment: DIP-249097X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural and mechanistic insight into covalent substrate binding by Escherichia coli dihydroxyacetone kinase. Shi R., McDonald L., Cui Q., Matte A., Cygler M., Ekiel I. Only protein-protein interactions imex curation shi-2011-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi R., McDonald L., Cui Q., Matte A., Cygler M., Ekiel I. DIP original experiment: DIP-249098X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural and mechanistic insight into covalent substrate binding by Escherichia coli dihydroxyacetone kinase. Shi R., McDonald L., Cui Q., Matte A., Cygler M., Ekiel I. Only protein-protein interactions imex curation shi-2011-6 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi R., McDonald L., Cui Q., Matte A., Cygler M., Ekiel I. DIP original experiment: DIP-249099X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural and mechanistic insight into covalent substrate binding by Escherichia coli dihydroxyacetone kinase. Shi R., McDonald L., Cui Q., Matte A., Cygler M., Ekiel I. Only protein-protein interactions imex curation dhak_ecoli PEP-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK dhaK b1200 ycgT JW5187 protein protein ecoli Escherichia coli (strain K12) MKKLINDVQDVLDEQLAGLAKAHPSLTLHQDPVYVTRADAPVAGKVALLSGGGSGHEPMHCGYIGQGMLSGACPGEIFTSPTPDKIFECAMQVDGGEGVLLIIKNYTGDILNFETATELLHDSGVKVTTVVIDDDVAVKDSLYTAGRRGVANTVLIEKLVGAAAERGDSLDACAELGRKLNNQGHSIGIALGACTVPAAGKPSFTLADNEMEFGVGIHGEPGIDRRPFSSLDQTVDEMFDTLLVNGSYHRTLRFWDYQQGSWQEEQQTKQPLQSGDRVIALVNNLGATPLSELYGVYNRLTTRCQQAGLTIERNLIGAYCTSLDMTGFSITLLKVDDETLALWDAPVHTPALNWGK dhal_ecoli PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL dhaL ycgS JW5186 b1199 protein protein ecoli Escherichia coli (strain K12) MSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE dhak-dhal-1 3220281 N/A 3220284 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3220285 unspecified role unspecified role unspecified role unspecified role P76014:p.Arg178Glu R178E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dhak-dhal-2 3220282 N/A 3220284 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3220285 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dhak-1 3220283 N/A 3220284 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false