DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ matsuura-2010-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm tem transmission electron microscopy tem predetermined predetermined participant predetermined Matsuura H., Kirschner AN., Longnecker R., Jardetzky TS. DIP original experiment: DIP-220683X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the Epstein-Barr virus (EBV) glycoprotein H/glycoprotein L (gH/gL) complex. Matsuura H., Kirschner AN., Longnecker R., Jardetzky TS. Only protein-protein interactions imex curation matsuura-2010-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Matsuura H., Kirschner AN., Longnecker R., Jardetzky TS. DIP original experiment: DIP-220681X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the Epstein-Barr virus (EBV) glycoprotein H/glycoprotein L (gH/gL) complex. Matsuura H., Kirschner AN., Longnecker R., Jardetzky TS. Only protein-protein interactions imex curation matsuura-2010-3 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Matsuura H., Kirschner AN., Longnecker R., Jardetzky TS. DIP original experiment: DIP-220682X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the Epstein-Barr virus (EBV) glycoprotein H/glycoprotein L (gH/gL) complex. Matsuura H., Kirschner AN., Longnecker R., Jardetzky TS. Only protein-protein interactions imex curation gl_ebvb9 Envelope glycoprotein L gL BKRF2 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MRAVGVFLAICLVTIFVLPTWGNWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG gh_ebvb9 Envelope glycoprotein H gH BXLF2 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MQLLCVFCLVLLWEVGAASLSEVKLHLDIEGHASHYTIPWTELMAKVPGLSPEALWREANVTEDLASMLNRYKLIYKTSGTLGIALAEPVDIPAVSEGSMQVDASKVHPGVISGLNSPACMLSAPLEKQLFYYIGTMLPNTRPHSYVFYQLRCHLSYVALSINGDKFQYTGAMTSKFLMGTYKRVTEKGDEHVLSLVFGKTKDLPDLRGPFSYPSLTSAQSGDYSLVIVTTFVHYANFHNYFVPNLKDMFSRAVTMTAASYARYVLQKLVLLEMKGGCREPELDTETLTTMFEVSVAFFKVGHAVGETGNGCVDLRWLAKSFFELTVLKDIIGICYGATVKGMQSYGLERLAAMLMATVKMEELGHLTTEKQEYALRLATVGYPKAGVYSGLIGGATSVLLSAYNRHPLFQPLHTVMRETLFIGSHVVLRELRLNVTTQGPNLALYQLLSTALCSALEIGEVLRGLALGTESGLFSPCYLSLRFDLTRDKLLSMAPQEATLDQAAVSNAVDGFLGRLSLEREDRDAWHLPAYKCVDRLDKVLMIIPLINVTFIISSDREVRGSALYEASTTYLSSSLFLSPVIMNKCSQGAVAGEPRQIPKIQNFTRTQKSCIFCGFALLSYDEKEGLETTTYITSQEVQNSILSSNYFDFDNLHVHYLLLTTNGTVMEIAGLYEERAHVVLAIILYFIAFALGIFLVHKIVMFFL gh-gl-5 3219065 N/A 3219068 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-137 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3219069 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 18-679 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gh-gl-6 3219066 N/A 3219068 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-137 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3219069 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 18-679 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gh-gl-7 3219067 N/A 3219068 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-137 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3219069 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 18-679 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false