DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hyde-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hyde SJ., Eckenroth BE., Smith BA., Eberley WA., Heintz NH., Jackman JE., Doublié S. DIP original experiment: DIP-220613X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx tRNA(His) guanylyltransferase (THG1), a unique 3'-5' nucleotidyl transferase, shares unexpected structural homology with canonical 5'-3' DNA polymerases. Hyde SJ., Eckenroth BE., Smith BA., Eberley WA., Heintz NH., Jackman JE., Doublié S. Only protein-protein interactions imex curation hyde-2010-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hyde SJ., Eckenroth BE., Smith BA., Eberley WA., Heintz NH., Jackman JE., Doublié S. DIP original experiment: DIP-220614X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx tRNA(His) guanylyltransferase (THG1), a unique 3'-5' nucleotidyl transferase, shares unexpected structural homology with canonical 5'-3' DNA polymerases. Hyde SJ., Eckenroth BE., Smith BA., Eberley WA., Heintz NH., Jackman JE., Doublié S. Only protein-protein interactions imex curation thg1_human Probable tRNA(His) guanylyltransferase Induced in high glucose-1 tRNA-histidine guanylyltransferase Interphase cytoplasmic foci protein 45 THG1L ICF45 protein protein human Homo sapiens Human MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS thg1l-1 3217369 N/A 3217371 unspecified role unspecified role unspecified role unspecified role Region 30-298 Region 30-298 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9NWX6:p.Thr127Ala T127A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false thg1l-2 3217370 N/A 3217371 unspecified role unspecified role unspecified role unspecified role Region 30-298 Region 30-298 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false