DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fokina-2010-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fokina O., Chellamuthu VR., Forchhammer K., Zeth K. DIP original experiment: DIP-220578X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Mechanism of 2-oxoglutarate signaling by the Synechococcus elongatus PII signal transduction protein. Fokina O., Chellamuthu VR., Forchhammer K., Zeth K. Only protein-protein interactions imex curation fokina-2010-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Fokina O., Chellamuthu VR., Forchhammer K., Zeth K. DIP original experiment: DIP-220579X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Mechanism of 2-oxoglutarate signaling by the Synechococcus elongatus PII signal transduction protein. Fokina O., Chellamuthu VR., Forchhammer K., Zeth K. Only protein-protein interactions imex curation glnb_syne7 Nitrogen regulatory protein P-II PII signal transducing protein glnB Synpcc7942_0321 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI argb_syne7 Acetylglutamate kinase NAG kinase N-acetyl-L-glutamate 5-phosphotransferase argB Synpcc7942_1496 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MSSEFIEAGAADRVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEINAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQEGIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAEKLILLTDTRGILEDPKRPESLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALLLEIFTDAGIGTMIVGSGYHEAHQPWQ glnb-1 3217095 N/A 3217097 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false argb-glnb-8 3217096 N/A 3217098 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3217097 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false