DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2010-77 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang T., Darwin KH., Li H. DIP original experiment: DIP-217685X Nature structural & molecular biology 2010 IMEx Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation. Wang T., Darwin KH., Li H. Only protein-protein interactions imex curation wang-2010-78 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang T., Darwin KH., Li H. DIP original experiment: DIP-217686X Nature structural & molecular biology 2010 IMEx Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation. Wang T., Darwin KH., Li H. Only protein-protein interactions imex curation wang-2010-79 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang T., Darwin KH., Li H. DIP original experiment: DIP-217688X Nature structural & molecular biology 2010 IMEx Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation. Wang T., Darwin KH., Li H. Only protein-protein interactions imex curation wang-2010-80 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang T., Darwin KH., Li H. DIP original experiment: DIP-217687X Nature structural & molecular biology 2010 IMEx Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation. Wang T., Darwin KH., Li H. Only protein-protein interactions imex curation arc_myctu Proteasome-associated ATPase AAA ATPase forming ring-shaped complexes Mycobacterial proteasome ATPase MTCY261.11c Rv2115c mpa protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MGESERSEAFGIPRDSPLSSGDAAELEQLRREAAVLREQLENAVGSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPKAEVEDLVLEEVPDVSYADIGGLSRQIEQIRDAVELPFLHKELYREYSLRPPKGVLLYGPPGCGKTLIAKAVANSLAKKMAEVRGDDAHEAKSYFLNIKGPELLNKFVGETERHIRLIFQRAREKASEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVPQLLSEIDGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEAAQDIYSKYLTEFLPVHADDLAEFDGDRSACIKAMIEKVVDRMYAEIDDNRFLEVTYANGDKEVMYFKDFNSGAMIQNVVDRAKKNAIKSVLETGQPGLRIQHLLDSIVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSSASRAIDTESNLGQYL This sequence has been withdrawn from Uniprot. 4D5F4E630614C58D mint pup_myctu Prokaryotic ubiquitin-like protein Pup Rv2111c Bacterial ubiquitin-like modifier pup protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ 7D958B770D8766E3 mint mpa-5 3216048 N/A 3216052 unspecified role unspecified role unspecified role unspecified role Coiled-coil domain Region 46-96 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mpa-pup-1 3216049 N/A 3216053 unspecified role unspecified role unspecified role unspecified role Region 21-64 Region 21-64 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3216052 unspecified role unspecified role unspecified role unspecified role Coiled-coil domain Region 46-96 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pup-mpa-2 3216050 N/A 3216053 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 21-64 Region 21-64 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3216052 unspecified role unspecified role prey prey Coiled-coil domain Region 46-96 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pup-mpa-3 3216051 N/A 3216053 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3216052 unspecified role unspecified role prey prey Coiled-coil domain Region 46-96 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false