DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wei-2010-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220471X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Wei H., Zhou MM. Only protein-protein interactions imex curation wei-2010-5 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wei H., Zhou MM. DIP original experiment: DIP-220475X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Wei H., Zhou MM. Only protein-protein interactions imex curation wei-2010-6 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220477X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Wei H., Zhou MM. Only protein-protein interactions imex curation wei-2010-7 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220472X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Wei H., Zhou MM. Only protein-protein interactions imex curation wei-2010-8 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220474X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Wei H., Zhou MM. Only protein-protein interactions imex curation wei-2010-9 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wei H., Zhou MM. DIP original experiment: DIP-220476X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Wei H., Zhou MM. Only protein-protein interactions imex curation wei-2010-10 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220473X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Wei H., Zhou MM. Only protein-protein interactions imex curation wei-2010-11 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wei H., Zhou MM. DIP original experiment: DIP-220478X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Dimerization of a viral SET protein endows its function. Wei H., Zhou MM. Only protein-protein interactions imex curation o41094_pbcv1 A612L protein protein pbcv1 Paramecium bursaria Chlorella virus 1 (PBCV-1) MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN h3-6 Histone 3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GKAPRKQLATKAARKSAPATGGV a612l-1 3215690 N/A 3215698 unspecified role unspecified role unspecified role unspecified role O41094:p.Met60Glu M60E/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Leu62Lys L62K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Leu62Ala L62A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Ile36Ala I36A/K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Met60Ala M60A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Ile36Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false O41094:p.Met60Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false a612l-a612l-1 3215691 N/A 3215698 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3215698 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false h3-a612l-1 3215692 N/A 3215699 unspecified role unspecified role fluorescence donor fluorescence donor Region 11-22 Region 11-22 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false ecolx Escherichia coli N/A 3215698 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false a612l-2 3215693 N/A 3215698 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false a612l-h3-1 3215694 N/A 3215699 unspecified role unspecified role unspecified role unspecified role Region 1-21 Region 1-21 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3215698 unspecified role unspecified role unspecified role unspecified role O41094:p.Met60Glu M60E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Leu62Lys L62K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Tyr105Phe Y105F mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false a612l-a612l-2 3215695 N/A 3215698 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3215698 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false a612l-h3-2 3215696 N/A 3215699 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-21 Region 1-21 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3215698 enzyme enzyme unspecified role unspecified role O41094:p.Leu62Asp L62D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Met60Asp M60E/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Ile36Ala I36A/K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Leu62Ala L62A/K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Tyr105Phe Y105F mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O41094:p.Met60Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false O41094:p.Leu62Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false O41094:p.Ile36Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli methylation methylation reaction methylation false false false a612l-h3-3 3215697 N/A 3215699 unspecified role unspecified role unspecified role unspecified role Region 13-20 Region 13-20 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3215698 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false