DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hothorn-2010-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hothorn M., Van den Ende W., Lammens W., Rybin V., Scheffzek K. DIP original experiment: DIP-220021X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural insights into the pH-controlled targeting of plant cell-wall invertase by a specific inhibitor protein. Hothorn M., Van den Ende W., Lammens W., Rybin V., Scheffzek K. Only protein-protein interactions imex curation hothorn-2010-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hothorn M., Van den Ende W., Lammens W., Rybin V., Scheffzek K. DIP original experiment: DIP-220022X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural insights into the pH-controlled targeting of plant cell-wall invertase by a specific inhibitor protein. Hothorn M., Van den Ende W., Lammens W., Rybin V., Scheffzek K. Only protein-protein interactions imex curation hothorn-2010-3 in vitro In vitro deglycosylase assay deglycosylase assay predetermined predetermined participant predetermined Hothorn M., Van den Ende W., Lammens W., Rybin V., Scheffzek K. DIP original experiment: DIP-220023X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural insights into the pH-controlled targeting of plant cell-wall invertase by a specific inhibitor protein. Hothorn M., Van den Ende W., Lammens W., Rybin V., Scheffzek K. Only protein-protein interactions imex curation o49908_tobac LOC107808322 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MKNLIFLTMFLTILLQTNANNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL inv1_arath Beta-fructofuranosidase, insoluble isoenzyme CWINV1 CWINV1 BFRUCT1 Cell wall beta-fructosidase 1 Cell wall invertase 1 Sucrose hydrolase 1 MMM17.26 At3g13790 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTKEVCSNIGLWLLLTLLIGNYVVNLEASHHVYKRLTQSTNTKSPSVNQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLINWDPHPPAIFPSAPFDINGCWSGSATILPNGKPVILYTGIDPKNQQVQNIAEPKNLSDPYLREWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDKKWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVETSSFGEPNEILKHVLKISLDDTKHDYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYYASKTFFDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVERLRTKQVKNLRNKVLKSGSRLEVYGVTAAQADVEVLFKVRDLEKADVIEPSWTDPQLICSKMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKEDNDKTTYGAFVDINPHQPLSLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAFNYGYQSVDVLNLNAWSMNSAQIS cwinv1-o49908_tobac-1 3214838 N/A 3214841 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214842 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false cwinv1-o49908_tobac-2 3214839 N/A 3214841 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214842 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false cwinv1-o49908_tobac-3 3214840 N/A 3214841 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214842 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false