DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ egea-2010-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Egea PF., Stroud RM. DIP original experiment: DIP-220015X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Egea PF., Stroud RM. Only protein-protein interactions imex curation egea-2010-2 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Egea PF., Stroud RM. DIP original experiment: DIP-220019X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Egea PF., Stroud RM. Only protein-protein interactions imex curation egea-2010-3 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Egea PF., Stroud RM. DIP original experiment: DIP-220018X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Egea PF., Stroud RM. Only protein-protein interactions imex curation egea-2010-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Egea PF., Stroud RM. DIP original experiment: DIP-220016X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Egea PF., Stroud RM. Only protein-protein interactions imex curation egea-2010-5 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Egea PF., Stroud RM. DIP original experiment: DIP-220020X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Egea PF., Stroud RM. Only protein-protein interactions imex curation egea-2010-6 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Egea PF., Stroud RM. DIP original experiment: DIP-220017X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes. Egea PF., Stroud RM. Only protein-protein interactions imex curation secy_pyrfu Protein translocase subunit SecY secY Protein transport protein SEC61 subunit alpha homolog PF1801 protein protein pyrfu Pyrococcus furiosus MGARDIIYALERWFPEVERPKRRVPLRERFMWTGVALILYYVLAEIPVYGIPERIQDYFQFLRVVLAGRNGSILTLGIGPIVTAGIILQLLVGSEIIKLDLANPEDRRFYQALQRVFSVFMCFFEAAVWILGGAFGRVGVDVTYAIAVLMILQLAMGGIVLIILDELVSKWGIGSGISLFIAAGVSQTILTRSLNPLTDPNIIDPLTGQPAIVGAIPYFIQHILKGDLWGAIYRGGSAPDMLSVVATIVVFFIVVYFESMRVEIPLGYRGVTVRGSYPIRFLYVSNIPIILTFALYANIQLWARVLDRLGHPWLGRFDPTTGSPISGFVLYVIPPRNIFSVIDNPVRAIVYLILTVIFSLLFGYLWVELTGLDARSIARQLQRAGLQIPGFRRDPRTLEKVLQRYIPYVTFWGSLTVALIAVLADFLGALGTGTGILLTVGILYRFYEEIAREQITEMFPALRKLFGA sece_pyrfu Protein translocase subunit SecE secE Protein transport protein Sec61 gamma subunit homolog PF1989 protein protein pyrfu Pyrococcus furiosus MAELQERIRHFWKESRRAFLVTKKPNWATYKRAAKITGLGIILIGLIGMLIRIVGILILGG secg_pyrfu Preprotein translocase subunit SecG secG Protein transport protein Sec61 subunit beta homolog PF2016 protein protein pyrfu Pyrococcus furiosus MAKEKTTLPPTGAGLMRFFDEDTKAVKVTPKGALAIVLVFILIEVLLQIIGPRIFG secy_ecoli Protein translocase subunit SecY secY prlA b3300 JW3262 protein protein ecoli Escherichia coli (strain K12) MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYGR secg_ecoli Protein-export membrane protein SecG P12 Preprotein translocase band 1 subunit JW3142 b3175 secG protein protein ecoli Escherichia coli (strain K12) MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN sece_ecoli Protein translocase subunit SecE JW3944 b3981 secE prlG protein protein ecoli Escherichia coli (strain K12) MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGLRF sece-secy-4 3214776 N/A 3214782 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214783 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sece-secg-3 3214777 N/A 3214784 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3214782 unspecified role unspecified role prey prey Region 1-453 Region 1-453 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3214783 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli association association false false false secy-sece-4 3214778 N/A 3214784 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3214782 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3214783 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false sece-secg-4 3214779 N/A 3214784 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214782 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214783 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false sece-secg-5 3214780 N/A 3214785 unspecified role unspecified role prey prey Region 1-423 Region 1-423 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3214786 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3214787 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli association association false false false sece-secg-6 3214781 N/A 3214784 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214782 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214783 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli association association false false false