DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2010-56 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252391X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions imex curation wang-2010-57 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252397X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions imex curation wang-2010-58 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252393X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions imex curation wang-2010-59 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252395X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions imex curation wang-2010-60 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252392X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions imex curation wang-2010-61 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252396X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions imex curation wang-2010-62 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252394X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions imex curation rmi1_human RecQ-mediated genome instability protein 1 BLM-associated protein of 75 kDa FAAP75 RMI1 C9orf76 protein protein human Homo sapiens Human MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK q96e14-1 RecQ-mediated genome instability protein 2 RMI2 C16orf75 BLM-associated protein of 18 kDa protein protein human Homo sapiens Human MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP blm_human Bloom syndrome protein RecQ protein-like 3 DNA helicase, RecQ-like type 2 BLM RECQ2 RECQL3 protein protein human Homo sapiens Human MAAVPQNNLQEQLERHSARTLNNKLSLSKPKFSGFTFKKKTSSDNNVSVTNVSVAKTPVLRNKDVNVTEDFSFSEPLPNTTNQQRVKDFFKNAPAGQETQRGGSKSLLPDFLQTPKEVVCTTQNTPTVKKSRDTALKKLEFSSSPDSLSTINDWDDMDDFDTSETSKSFVTPPQSHFVRVSTAQKSKKGKRNFFKAQLYTTNTVKTDLPPPSSESEQIDLTEEQKDDSEWLSSDVICIDDGPIAEVHINEDAQESDSLKTHLEDERDNSEKKKNLEEAELHSTEKVPCIEFDDDDYDTDFVPPSPEEIISASSSSSKCLSTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSVSPGDCLLTTTLGKTGFSATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASINDLERETQPSYDIDNFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERLSSAKTDCLPVSSTAQNINFSESIQNYTDKSAQNLASRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGANSKLGIMAPPKPINRPFLKPSYAFS top3a_human DNA topoisomerase 3-alpha DNA topoisomerase III alpha TOP3A TOP3 protein protein human Homo sapiens Human MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRRREGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEKYCPENFVDIKKTLERETRQCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLISYGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYISYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYFGNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQSLNRMDNSQHPQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLESEARSKRPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR rmi1-rmi2-5 3214184 N/A 3214191 unspecified role unspecified role bait bait C-terminal domain Region 475-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3214192 unspecified role unspecified role prey prey Region 6-147 Region 6-147 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rmi2-blm-2 3214185 N/A 3214193 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3214194 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3214191 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3214192 unspecified role unspecified role bait bait Q96E14-1:p.Met134Arg M134R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q96E14-1:p.Asp141Ala D141A/R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q96E14-1:p.Asp141Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false rmi1-rmi2-6 3214186 N/A 3214191 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 475-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3214192 unspecified role unspecified role unspecified role unspecified role Region 6-147 Region 6-147 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rmi1-blm-1 3214187 N/A 3214193 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3214194 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3214191 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3214192 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false rmi2-rmi1-2 3214188 N/A 3214191 unspecified role unspecified role prey prey C-terminal domain Region 475-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3214192 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 6-147 Region 6-147 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rmi1-rmi2-7 3214189 N/A 3214191 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3214192 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false rmi1-rmi2-8 3214190 N/A 3214191 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 475-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3214192 unspecified role unspecified role unspecified role unspecified role Region 6-147 Region 6-147 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false