DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ benirschke-2010-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. DIP original experiment: DIP-217159X Structure (London, England : 1993) 2010 IMEx Molecular basis for the association of human E4B U box ubiquitin ligase with E2-conjugating enzymes UbcH5c and Ubc4. Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. Only protein-protein interactions imex curation benirschke-2010-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. DIP original experiment: DIP-217162X Structure (London, England : 1993) 2010 IMEx Molecular basis for the association of human E4B U box ubiquitin ligase with E2-conjugating enzymes UbcH5c and Ubc4. Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. Only protein-protein interactions imex curation benirschke-2010-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. DIP original experiment: DIP-217160X Structure (London, England : 1993) 2010 IMEx Molecular basis for the association of human E4B U box ubiquitin ligase with E2-conjugating enzymes UbcH5c and Ubc4. Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. Only protein-protein interactions imex curation benirschke-2010-4 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. DIP original experiment: DIP-217163X Structure (London, England : 1993) 2010 IMEx Molecular basis for the association of human E4B U box ubiquitin ligase with E2-conjugating enzymes UbcH5c and Ubc4. Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. Only protein-protein interactions imex curation benirschke-2010-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. DIP original experiment: DIP-217161X Structure (London, England : 1993) 2010 IMEx Molecular basis for the association of human E4B U box ubiquitin ligase with E2-conjugating enzymes UbcH5c and Ubc4. Benirschke RC., Thompson JR., Nominé Y., Wasielewski E., Juranić N., Macura S., Hatakeyama S., Nakayama KI., Botuyan MV., Mer G. Only protein-protein interactions imex curation p61077-1 Ubiquitin-conjugating enzyme E2 D3 UBE2D3 UBC5C UBCH5C (E3-independent) E2 ubiquitin-conjugating enzyme D3 E2 ubiquitin-conjugating enzyme D3 Ubiquitin carrier protein D3 Ubiquitin-conjugating enzyme E2(17)KB 3 Ubiquitin-conjugating enzyme E2-17 kDa 3 Ubiquitin-protein ligase D3 protein protein human Homo sapiens Human MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM o95155-1 Ubiquitin conjugation factor E4 B UBE4B HDNB1 KIAA0684 UFD2 Homozygously deleted in neuroblastoma 1 RING-type E3 ubiquitin transferase E4 B Ubiquitin fusion degradation protein 2 protein protein human Homo sapiens Human MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNMTPATSPIGASGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQVDVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSSPSPPALASSPQAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIETCKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPRSLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDYFKYPLMALGELCETKFGKTHPVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVFAEDDVKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSYMAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTKIKLETVDPTYIFHPRCRITLPNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRLRAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFLRRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSPQALYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHPLSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSGKQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDERVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIAIEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH ub2d2_human Ubiquitin-conjugating enzyme E2 D2 UBC5B UBCH4 UBE2D2 UBC4 UBCH5B Ubiquitin-protein ligase D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-conjugating enzyme E2(17)KB 2 PUBC1 p53-regulated ubiquitin-conjugating enzyme 1 (E3-independent) E2 ubiquitin-conjugating enzyme D2 E2 ubiquitin-conjugating enzyme D2 protein protein human Homo sapiens Human MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM ube2d3-ube4b-1 3212302 N/A 3212307 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212308 unspecified role unspecified role unspecified role unspecified role U-box domain Region 1208-1302 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ube2d3-ube4b-2 3212303 N/A 3212307 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212308 unspecified role unspecified role unspecified role unspecified role U-box domain Region 1208-1302 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ube2d3-ube4b-3 3212304 N/A 3212307 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212308 unspecified role unspecified role unspecified role unspecified role U-box domain Region 1208-1302 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ube2d2-ube4b-1 3212305 N/A 3212309 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212308 unspecified role unspecified role unspecified role unspecified role U-box domain Region 1208-1302 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ube2d2-ube4b-2 3212306 N/A 3212309 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212308 unspecified role unspecified role unspecified role unspecified role U-box domain Region 1208-1302 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false